StarFunc result for job id Q6VMQ6

User Input

>input (1270 residues)
MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLE
NMDYIKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPE
PVSKLPAEPVSGDPAPGDLDAGDPASGVLASGDSTSGDPTSSEPSSSDAASGDATSGDAP
SGDVSPGDATSGDATADDLSSGDPTSSDPIPGEPVPVEPISGDCAADDIASSEITSVDLA
SGAPASTDPASDDLASGDLSSSELASDDLATGELASDELTSESTFDRTFEPKSVPVCEPV
PEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEETLETDDTTIC
SDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKS
ENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPSK
QESSESLPKEAFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIHE
DDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQ
WLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKRFEAAKEDL
KKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLESKRNVSESAPPSFQTPVNTV
SSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSGNPQPTISLQP
LPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPN
PTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSP
STNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATG
SDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTS
GPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGTV
MQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQLTVHHRPPQVHTEPPRPVHPA
PLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLYA
YHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQS
TDVISSTQSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAY1	0.163	0.163	0.000	1270	1.000	1.000	A0A024RAY1.pdb.gz
2	AFDB:Q7TT18	0.181	0.178	0.000	1306	0.754	0.734	Q7TT18.pdb.gz	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
3	AFDB:Q7KMH9	0.105	0.095	2.577E-17	1420	0.188	0.168	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
4	AFDB:Q04164	0.072	0.055	6.426E-7	1693	0.143	0.107	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
5	AFDB:B7YZW3	0.075	0.048	2.015E-6	2064	0.113	0.069	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
6	AFDB:Q4ZHG4	0.076	0.052	3.404E-5	1894	0.151	0.101	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
7	AFDB:Q2Q0I9	0.078	0.057	1.727E-4	1779	0.151	0.108	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
8	AFDB:Q59IW6	0.074	0.079	2.968E-4	1179	0.120	0.129	Q59IW6.pdb.gz	Q59IW6_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
9	AFDB:Q59IW9	0.071	0.082	6.889E-4	1079	0.088	0.104	Q59IW9.pdb.gz	Q59IW9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
10	PDB:3besR	0.064	0.278	1.801E-3	250	0.008	0.040	3besR.pdb.gz
11	PDB:7u7nC	0.069	0.400	1.913E-3	200	0.016	0.100	7u7nC.pdb.gz
12	AFDB:O14029	0.030	0.024	2.294E-3	1995	0.154	0.098	O14029.pdb.gz	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
13	PDB:5mj3A	0.059	0.211	8.103E-3	302	0.011	0.046	5mj3A.pdb.gz
14	PDB:7z0lB	0.053	0.158	1.570E-2	370	0.011	0.038	7z0lB.pdb.gz
15	PDB:6pyhD	0.067	0.102	2.121E-2	798	0.017	0.026	6pyhD.pdb.gz
16	PDB:5iv5BJ	0.055	0.068	2.698E-2	1004	0.012	0.015	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
17	PDB:8eyyA	0.069	0.108	3.871E-2	775	0.011	0.018	8eyyA.pdb.gz
18	PDB:3pfqA	0.062	0.132	4.924E-2	523	0.006	0.015	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
19	PDB:3csbA	0.063	0.163	5.898E-2	464	0.010	0.028	3csbA.pdb.gz	A Dominant Conformational Role for Amino Acid Diversity in Minimalist Protein-Protein Interfaces
20	PDB:6pxvA	0.071	0.107	5.898E-2	823	0.010	0.016	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MV73	0.0	1013	515	0.406	1.000	A8MV73_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=2
2	Q6VMQ6	0.0	2563	1270	1.000	1.000	MCAF1_HUMAN Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3
3	Q7TT18	0.0	1748	1306	0.747	0.727	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
4	F5H1K9	4.67e-116	360	176	0.139	1.000	F5H1K9_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=8
5	F5H502	4.67e-116	360	176	0.139	1.000	F5H502_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=1
6	F5GZ10	3.33e-111	347	169	0.133	1.000	F5GZ10_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=1
7	F5H2H9	1.74e-110	345	168	0.132	1.000	F5H2H9_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=8
8	F5H2W9	5.03e-100	316	152	0.120	1.000	F5H2W9_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=1
9	F5H8I0	1.23e-85	276	132	0.104	1.000	F5H8I0_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=1
10	F8WE35	6.62e-81	262	125	0.098	1.000	F8WE35_HUMAN Activating transcription factor 7 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=1
11	Q7KMH9	6.89e-20	99.0	1420	0.053	0.047	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
12	P26436	5.14e-04	45.8	265	0.027	0.128	ASPX_HUMAN Acrosomal protein SP-10 OS=Homo sapiens OX=9606 GN=ACRV1 PE=1 SV=2
13	G8B4T8	0.84	36.6	1429	0.033	0.029	G8B4T8_CANPC Hyphally-regulated cell wall protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=HYR31 PE=4 SV=1
14	A0A509ASE5	5.6	33.9	5367	0.050	0.012	A0A509ASE5_PLABA Protein SOC2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_1442200 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16788 ATF7IP_BD	1.2e-71	253.1	ATF-interacting protein binding domain
2	PF19128 DUF5811	4.3e+02	12.5	Family of unknown function (DUF5811)
3	PF16794 fn3_4	9.7e-37	136.4	Fibronectin-III type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000271640	0.999	Histone-lysine N-methyltransferase SETDB1
2	9606.ENSP00000405965	0.975	Small ubiquitin-related modifier 2
3	9606.ENSP00000282032	0.967	ARL14 effector protein
4	9606.ENSP00000329357	0.950	Transcription factor Sp1
5	9606.ENSP00000468785	0.931	Methyl-CpG-binding domain protein 1
6	9606.ENSP00000313854	0.776	Cleft lip and palate transmembrane protein 1-like protein
7	9606.ENSP00000348168	0.755	Transcription initiation factor IIE subunit beta
8	9606.ENSP00000354361	0.749	E3 ubiquitin-protein ligase RFWD3
9	9606.ENSP00000240361	0.744	Inactive serine/threonine-protein kinase TEX14
10	9606.ENSP00000371711	0.720	Doublesex- and mab-3-related transcription factor 1
11	9606.ENSP00000385334	0.715	Mitotic spindle assembly checkpoint protein MAD1
12	9606.ENSP00000346175	0.712	Histone-lysine N-methyltransferase SETDB2
13	9606.ENSP00000283875	0.711	General transcription factor IIE subunit 1
14	9606.ENSP00000344967	0.705	Protein sprouty homolog 4
15	9606.ENSP00000291582	0.697	Autoimmune regulator
16	9606.ENSP00000399465	0.696	Cyclic AMP-dependent transcription factor ATF-7
17	9606.ENSP00000322915	0.690	Zinc finger MYM-type protein 4
18	9606.ENSP00000384367	0.690	BTB/POZ domain-containing protein KCTD1
19	9606.ENSP00000273352	0.674	Adhesion G-protein coupled receptor G7
20	9606.ENSP00000367715	0.667	Doublecortin domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.997	catalytic activity
GO:0016887	0.988	ATP hydrolysis activity
GO:0003714	0.987	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0009987	0.988	cellular process
GO:0048522	0.988	positive regulation of cellular process
GO:0044238	0.984	primary metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0051173	0.975	positive regulation of nitrogen compound metabolic process
GO:0031325	0.975	positive regulation of cellular metabolic process
GO:0044237	0.969	cellular metabolic process
GO:0034641	0.929	cellular nitrogen compound metabolic process
GO:1901360	0.928	organic cyclic compound metabolic process
GO:0060255	0.914	regulation of macromolecule metabolic process
GO:0045935	0.892	positive regulation of nucleobase-containing compound metabolic process
GO:0006725	0.890	cellular aromatic compound metabolic process
GO:0051253	0.877	negative regulation of RNA metabolic process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0010556	0.865	regulation of macromolecule biosynthetic process
GO:0031326	0.865	regulation of cellular biosynthetic process
GO:0006355	0.845	regulation of DNA-templated transcription
GO:1902679	0.824	negative regulation of RNA biosynthetic process
GO:0006357	0.815	regulation of transcription by RNA polymerase II
GO:0045892	0.808	negative regulation of DNA-templated transcription
GO:0046483	0.749	heterocycle metabolic process
GO:0006139	0.710	nucleobase-containing compound metabolic process
GO:0090304	0.704	nucleic acid metabolic process
GO:0044260	0.673	cellular macromolecule metabolic process
GO:0051254	0.525	positive regulation of RNA metabolic process
GO:0006259	0.494	DNA metabolic process
GO:0051128	0.466	regulation of cellular component organization
GO:0009891	0.439	positive regulation of biosynthetic process
GO:0031328	0.409	positive regulation of cellular biosynthetic process
GO:0044089	0.406	positive regulation of cellular component biogenesis
GO:0010557	0.403	positive regulation of macromolecule biosynthetic process
GO:0010638	0.399	positive regulation of organelle organization
GO:0033044	0.392	regulation of chromosome organization
GO:1903508	0.387	positive regulation of nucleic acid-templated transcription
GO:0043412	0.386	macromolecule modification
GO:0045893	0.379	positive regulation of DNA-templated transcription
GO:2001252	0.377	positive regulation of chromosome organization
GO:0031647	0.302	regulation of protein stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.996	cytosol
GO:0016604	0.949	nuclear body
GO:0032991	0.502	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.988	ATP + H2O = ADP + H(+) + phosphate

[back to server]