StarFunc result for job id Q6VUC0

User Input

>input (442 residues)
MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEFQPPYFPPPYP
QPPLPYGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPP
ARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLL
DQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSLLSSTSKYKVTVGE
VQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLV
EGEAVHLARDFGYVCETEFPAKAAAEYLCRQHADPGELHSRKSMLLAAKQICKEFADLMA
QDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDKMF
LSSVGSGHGETKASEKDAKHRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6VUC0	1.000	1.000	9.145E-57	442	1.000	1.000	Q6VUC0.pdb.gz	AP2E_HUMAN Transcription factor AP-2-epsilon OS=Homo sapiens OX=9606 GN=TFAP2E PE=2 SV=1
2	AFDB:Q5PQZ4	0.543	0.540	2.066E-34	445	0.561	0.557	Q5PQZ4.pdb.gz	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
3	AFDB:Q9U479	0.133	0.099	8.988E-1	638	0.163	0.113	Q9U479.pdb.gz	Q9U479_DROME Short stop/Kakapo isoform C (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=2
4	AFDB:F1REK0	0.131	0.071	1.628	1072	0.161	0.066	F1REK0.pdb.gz	F1REK0_DANRE Histone deacetylase complex subunit SAP130 OS=Danio rerio OX=7955 GN=zgc:162722 PE=1 SV=1
5	AFDB:A2ALU4	0.141	0.056	1.710	1481	0.147	0.044	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
6	AFDB:A0A0B4LFI1	0.085	0.041	1.888	1089	0.158	0.064	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
7	AFDB:B9EK46	0.105	0.042	1.888	1203	0.165	0.061	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
8	AFDB:G5EB07	0.077	0.074	1.888	461	0.138	0.132	G5EB07.pdb.gz	G5EB07_EMENI GATA-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nsdD PE=4 SV=1
9	PDB:3c8eA	0.074	0.105	2.234	284	0.038	0.060	3c8eA.pdb.gz	Structure and Function of YghU, a Nu-Class Glutathione Transferase Related to YfcG from Escherichia coli.
10	AFDB:A0A0B4LF79	0.083	0.044	2.541	1000	0.158	0.070	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
11	AFDB:A0A0B4LFF3	0.088	0.049	2.806	936	0.163	0.077	A0A0B4LFF3.pdb.gz	A0A0B4LFF3_DROME Stac-like, isoform P OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	PDB:4jbwH	0.115	0.109	3.006	472	0.048	0.044	4jbwH.pdb.gz
13	PDB:7qa8B	0.108	0.149	3.319	299	0.063	0.094	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.
14	PDB:2ff4A	0.119	0.129	3.487	379	0.068	0.079	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:7jq9A	0.075	0.020	3.487	2427	0.059	0.011	7jq9A.pdb.gz
16	PDB:4jbwF	0.116	0.106	3.850	492	0.050	0.045	4jbwF.pdb.gz
17	PDB:6ezyB	0.100	0.173	3.850	212	0.045	0.094	6ezyB.pdb.gz	Redox-regulated methionine oxidation of Arabidopsis thaliana glutathione transferase Phi9 induces H-site flexibility.
18	PDB:1huwA	0.107	0.189	4.045	166	0.050	0.133	1huwA.pdb.gz
19	PDB:2jj1G	0.090	0.209	4.251	167	0.025	0.066	2jj1G.pdb.gz	Mechanism of Inhibition of Bovine F1-ATPase by Resveratrol and Related Polyphenols.
20	PDB:7aaqA	0.064	0.060	4.251	487	0.041	0.037	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6VUC0	0.0	878	442	1.000	1.000	AP2E_HUMAN Transcription factor AP-2-epsilon OS=Homo sapiens OX=9606 GN=TFAP2E PE=2 SV=1
2	Q6VUP9	0.0	739	442	0.932	0.932	AP2E_MOUSE Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2
3	Q6P0E7	3.31e-179	509	423	0.652	0.681	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1
4	D4A505	2.48e-174	497	441	0.647	0.649	D4A505_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=2
5	Q4TTV4	1.82e-168	482	439	0.631	0.636	Q4TTV4_DANRE Transcription factor AP-2 beta isoform OS=Danio rerio OX=7955 GN=zgc:110163 PE=2 SV=1
6	A0A0G2KAT2	4.72e-167	479	459	0.629	0.606	A0A0G2KAT2_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=1
7	Q61313	4.72e-167	479	459	0.629	0.606	AP2B_MOUSE Transcription factor AP-2-beta OS=Mus musculus OX=10090 GN=Tfap2b PE=1 SV=2
8	Q92481	3.67e-166	477	460	0.627	0.602	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
9	O93346	4.39e-165	474	449	0.624	0.615	O93346_CHICK Transcription factor AP-2 beta OS=Gallus gallus OX=9031 PE=2 SV=1
10	O13111	4.63e-163	468	437	0.600	0.606	O13111_CHICK Transcription factor AP-2-alpha OS=Gallus gallus OX=9031 PE=2 SV=2
11	Q6NYI3	6.71e-162	465	425	0.600	0.624	Q6NYI3_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
12	P34056	1.71e-161	464	437	0.597	0.604	AP2A_MOUSE Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2
13	P05549	2.89e-161	464	437	0.595	0.602	AP2A_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
14	A0A6E1XE14	3.31e-161	464	439	0.595	0.599	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
15	P58197	3.97e-161	463	437	0.590	0.597	AP2A_RAT Transcription factor AP-2-alpha OS=Rattus norvegicus OX=10116 GN=Tfap2a PE=1 SV=1
16	F1QUT4	9.82e-156	449	437	0.579	0.586	F1QUT4_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
17	A0A2R8QRQ5	2.03e-155	449	450	0.579	0.569	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
18	Q5PQZ4	5.45e-138	405	445	0.462	0.458	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
19	Q61312	4.76e-128	379	449	0.529	0.521	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
20	Q92754	1.82e-124	370	450	0.527	0.518	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03299 TF_AP-2	2.6e-77	270.7	Transcription factor AP-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384367	0.802	BTB/POZ domain-containing protein KCTD1
2	9606.ENSP00000394390	0.802	BTB/POZ domain-containing protein KCTD15
3	9606.ENSP00000247843	0.680	YEATS domain-containing protein 4
4	9606.ENSP00000401764	0.658	Cbp/p300-interacting transactivator 1
5	9606.ENSP00000263253	0.642	Histone acetyltransferase p300
6	9606.ENSP00000482704	0.635	Dehydrogenase/reductase SDR family member 11
7	9606.ENSP00000262367	0.632	CREB-binding protein
8	9606.ENSP00000444198	0.623	Cbp/p300-interacting transactivator 2
9	9606.ENSP00000320604	0.614	Fatty acid hydroxylase domain containing 2
10	9606.ENSP00000361721	0.600	Cbp/p300-interacting transactivator 4
11	9606.ENSP00000485478	0.587	Cadherin-related family member 1
12	9606.ENSP00000220812	0.564	Dickkopf-related protein 4
13	9606.ENSP00000368720	0.553	Controls the stability of the leptin mRNA harboring an AU- rich element (ARE) in its 3' UTR, in cooperation with the RNA stabilizer ELAVL1 . Decreases the stability of the leptin mRNA by antagonizing the function of ELAVL1 by inducing its atypical recruitment from the nucleus to the cytosol (By similarity). Binds to cardiolipin (CL), phosphatidic acid (PA), phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylserine (PS) . Promotes apoptosis by enhancing BAX-BAK hetero-oligomerization via interaction with BID in colon cancer cells (By similarity). ECO:0000269\|PubMed:18191643, [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.998	transcription regulator activity
GO:0003700	0.994	DNA-binding transcription factor activity
GO:0000981	0.922	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.917	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.965	positive regulation of cellular process
GO:0006357	0.959	regulation of transcription by RNA polymerase II
GO:0009893	0.936	positive regulation of metabolic process
GO:0031325	0.927	positive regulation of cellular metabolic process
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0051173	0.915	positive regulation of nitrogen compound metabolic process
GO:0045935	0.825	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.821	positive regulation of DNA-templated transcription
GO:0045944	0.738	positive regulation of transcription by RNA polymerase II
GO:0032502	0.666	developmental process
GO:0048856	0.640	anatomical structure development
GO:0032501	0.613	multicellular organismal process
GO:0007275	0.579	multicellular organism development
GO:0009987	0.552	cellular process
GO:0048731	0.458	system development
GO:0048513	0.334	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.965	nucleoplasm
GO:0005737	0.540	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]