StarFunc result for job id Q6VVB1

User Input

>input (395 residues)
MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAH
PRTLALECPFCRRACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTF
GGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDV
TITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLH
LLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSS
MQLVGQVDTFGLSLYFPSKITASAVTFDHQGNVIVADTSGPAILCLGKPEEFPVPKPMVT
HGLSHPVALTFTKENSLLVLDTASHSIKVYKVDWG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6VVB1	1.000	1.000	2.302E-84	395	1.000	1.000	Q6VVB1.pdb.gz	NHLC1_HUMAN E3 ubiquitin-protein ligase NHLRC1 OS=Homo sapiens OX=9606 GN=NHLRC1 PE=1 SV=2
2	AFDB:Q8BR37	0.945	0.931	1.734E-68	401	0.818	0.805	Q8BR37.pdb.gz	NHLC1_MOUSE E3 ubiquitin-protein ligase NHLRC1 OS=Mus musculus OX=10090 GN=Nhlrc1 PE=2 SV=1
3	AFDB:Q8CH72	0.619	0.381	8.881E-24	655	0.281	0.169	Q8CH72.pdb.gz	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
4	AFDB:A0A0R4IL45	0.616	0.374	1.062E-22	663	0.276	0.164	A0A0R4IL45.pdb.gz	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
5	AFDB:D3ZQG6	0.549	0.302	1.016E-17	744	0.152	0.081	D3ZQG6.pdb.gz	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
6	AFDB:F1QFW2	0.568	0.312	1.495E-17	744	0.162	0.086	F1QFW2.pdb.gz	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
7	AFDB:M9PH32	0.576	0.202	2.456E-17	1206	0.139	0.046	M9PH32.pdb.gz	M9PH32_DROME Meiotic P26, isoform C OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=1 SV=1
8	AFDB:O70277	0.569	0.312	9.748E-17	744	0.162	0.086	O70277.pdb.gz	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
9	AFDB:Q2Q1W2	0.564	0.269	7.096E-16	868	0.170	0.077	Q2Q1W2.pdb.gz	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
10	AFDB:A0A0B4LFW8	0.557	0.182	8.847E-16	1277	0.159	0.049	A0A0B4LFW8.pdb.gz	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
11	PDB:2h9lA	0.483	0.577	3.484E-11	321	0.132	0.162	2h9lA.pdb.gz
12	PDB:5yzgs	0.490	0.514	2.271E-10	374	0.089	0.094	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:5mzhB	0.466	0.447	2.400E-10	415	0.109	0.104	5mzhB.pdb.gz
14	PDB:7mq8LS	0.459	0.409	3.162E-10	453	0.116	0.102	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6lqsB1	0.450	0.237	4.651E-10	806	0.094	0.046	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:7jvrB	0.487	0.551	4.915E-10	342	0.111	0.129	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:5nnzA	0.405	0.466	6.842E-10	335	0.104	0.122	5nnzA.pdb.gz
18	PDB:6bk8M	0.444	0.522	1.188E-9	326	0.134	0.163	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:5yzgW	0.442	0.403	1.481E-9	440	0.106	0.095	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7mq8LN	0.469	0.289	1.846E-9	671	0.094	0.055	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6VVB1	0.0	805	395	1.000	1.000	NHLC1_HUMAN E3 ubiquitin-protein ligase NHLRC1 OS=Homo sapiens OX=9606 GN=NHLRC1 PE=1 SV=2
2	Q8BR37	0.0	624	401	0.810	0.798	NHLC1_MOUSE E3 ubiquitin-protein ligase NHLRC1 OS=Mus musculus OX=10090 GN=Nhlrc1 PE=2 SV=1
3	Q8CH72	5.93e-15	79.0	655	0.248	0.150	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
4	Q13049	1.34e-14	77.8	653	0.256	0.155	TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2
5	Q9U489	3.06e-12	70.9	1147	0.159	0.055	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
6	Q2Q1W2	4.74e-12	70.1	868	0.175	0.079	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
7	A0A0R4IL45	7.79e-12	69.3	663	0.182	0.109	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
8	A8WGA9	7.86e-12	69.3	663	0.182	0.109	A8WGA9_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=2 SV=1
9	Q1PSW8	1.44e-11	68.6	855	0.172	0.080	LIN41_MOUSE E3 ubiquitin-protein ligase TRIM71 OS=Mus musculus OX=10090 GN=Trim71 PE=1 SV=1
10	E7FAM5	2.94e-11	67.4	824	0.192	0.092	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
11	Q9V4M2	7.69e-11	66.2	832	0.185	0.088	WECH_DROME Protein wech OS=Drosophila melanogaster OX=7227 GN=wech PE=1 SV=2
12	Q9R1R2	5.82e-10	63.5	744	0.162	0.086	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
13	O75382	7.14e-10	63.2	744	0.162	0.086	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
14	O70277	1.19e-09	62.4	744	0.154	0.082	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
15	F1QFW2	1.31e-09	62.4	744	0.162	0.086	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
16	A0A0B4LFP7	3.38e-09	61.2	1248	0.147	0.046	A0A0B4LFP7_DROME Thin, isoform D OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
17	Q7JUV6	3.53e-09	61.2	1353	0.147	0.043	Q7JUV6_DROME GH06739p OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	A0A0B4LFW8	4.01e-09	60.8	1277	0.147	0.045	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
19	B7YZK8	4.03e-09	61.2	1517	0.147	0.038	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
20	Q58ER5	4.51e-09	60.8	744	0.162	0.086	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	1.1	20.7	Baculovirus immediate-early protein (IE-0)
2	PF01436 NHL	6.6e-12	56.0	NHL repeat
3	PF14447 Prok-RING_4	0.8	20.9	Prokaryotic RING finger family 4
4	PF00097 zf-C3HC4	29	15.9	Zinc finger, C3HC4 type (RING finger)
5	PF15227 zf-C3HC4_4	8	18.0	zinc finger of C3HC4-type, RING
6	PF13639 zf-RING_2	0.02	26.6	Ring finger domain
7	PF14634 zf-RING_5	0.00043	31.5	zinc-RING finger domain
8	PF13445 zf-RING_UBOX	0.019	26.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356489	0.999	Laforin
2	9606.ENSP00000317904	0.984	Glycogen [starch] synthase, muscle
3	9606.ENSP00000238994	0.983	Protein phosphatase 1 regulatory subunit 3C
4	9606.ENSP00000340736	0.949	Glycogenin-1
5	9606.ENSP00000219548	0.938	E3 ubiquitin-protein ligase CHIP
6	9606.ENSP00000261195	0.929	Glycogen [starch] synthase, liver
7	9606.ENSP00000304697	0.928	Polyubiquitin-B
8	9606.ENSP00000370555	0.925	Glycogenin-2
9	9606.ENSP00000272317	0.904	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000441543	0.904	Polyubiquitin-C
11	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000302961	0.869	Heat shock protein family A member 4
13	9606.ENSP00000294724	0.840	Glycogen debranching enzyme
14	9606.ENSP00000347836	0.786	Ubiquitin-conjugating enzyme E2 H
15	9606.ENSP00000339764	0.647	PR domain zinc finger protein 8
16	9606.ENSP00000291568	0.645	Cystatin-B
17	9606.ENSP00000259711	0.641	Kinesin-like protein KIF13A
18	9606.ENSP00000275532	0.641	BTB/POZ domain-containing protein KCTD7
19	9606.ENSP00000405111	0.630	Putative ATP-dependent RNA helicase DHX57
20	9606.ENSP00000225567	0.619	Golgi SNAP receptor complex member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044265	0.995	cellular macromolecule catabolic process
GO:0043161	0.992	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0016567	0.989	protein ubiquitination
GO:0034645	0.985	cellular macromolecule biosynthetic process
GO:0005977	0.976	glycogen metabolic process
GO:0009250	0.976	glucan biosynthetic process
GO:0005978	0.945	glycogen biosynthetic process
GO:0050789	0.588	regulation of biological process
GO:0050794	0.534	regulation of cellular process
GO:0000209	0.392	protein polyubiquitination
GO:0048518	0.330	positive regulation of biological process
GO:0019222	0.323	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.957	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]