StarFunc result for job id Q6VVX0

User Input

>input (501 residues)
MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIGNIYSLAASSE
LPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTK
MGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKILEETKFFNDAIETYKGRPFDFK
QLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPF
GKHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENL
IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPY
TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVF
HPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPD
LKPRLGMTLQPQPYLICAERR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6VVX0	1.000	1.000	5.697E-82	501	1.000	1.000	Q6VVX0.pdb.gz	CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens OX=9606 GN=CYP2R1 PE=1 SV=1
2	AFDB:Q6VVW9	0.987	0.987	2.127E-75	501	0.882	0.882	Q6VVW9.pdb.gz	CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus OX=10090 GN=Cyp2r1 PE=1 SV=1
3	PDB:3c6gB	0.922	0.989	9.404E-72	467	0.924	0.991	3c6gB.pdb.gz	Structural analysis of CYP2R1 in complex with vitamin D3.
4	AFDB:F6P2A1	0.967	0.957	2.801E-63	506	0.669	0.662	F6P2A1.pdb.gz	F6P2A1_DANRE Cytochrome P450, family 2, subfamily R, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp2r1 PE=3 SV=1
5	AFDB:P51589	0.931	0.929	4.037E-43	502	0.429	0.428	P51589.pdb.gz	CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP2J2 PE=1 SV=2
6	AFDB:Q7Z449	0.914	0.843	2.570E-42	544	0.407	0.375	Q7Z449.pdb.gz	CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens OX=9606 GN=CYP2U1 PE=1 SV=1
7	AFDB:O54749	0.937	0.937	7.805E-42	501	0.403	0.403	O54749.pdb.gz	CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus OX=10090 GN=Cyp2j5 PE=1 SV=1
8	AFDB:O54750	0.926	0.926	1.184E-41	501	0.415	0.415	O54750.pdb.gz	CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cyp2j6 PE=2 SV=2
9	AFDB:Q64680	0.915	0.917	4.530E-41	500	0.395	0.396	Q64680.pdb.gz	CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus OX=10116 GN=Cyp2d4 PE=2 SV=1
10	AFDB:Q9DEW9	0.903	0.923	7.537E-41	490	0.391	0.400	Q9DEW9.pdb.gz	Q9DEW9_ICTPU Cytochrome P450 OS=Ictalurus punctatus OX=7998 GN=LOC100335049 PE=2 SV=1
11	AFDB:O35293	0.917	0.935	8.659E-41	491	0.379	0.387	O35293.pdb.gz	CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus OX=10116 GN=Cyp2f2 PE=2 SV=1
12	PDB:3tbgA	0.866	0.927	1.097E-37	467	0.371	0.398	3tbgA.pdb.gz	Contributions of Ionic Interactions and Protein Dynamics to Cytochrome P450 2D6 (CYP2D6) Substrate and Inhibitor Binding.
13	PDB:2vn0A	0.857	0.921	3.181E-37	464	0.325	0.351	2vn0A.pdb.gz	Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid.
14	PDB:4i91A	0.867	0.931	4.879E-36	465	0.323	0.348	4i91A.pdb.gz	Structural and Thermodynamic Basis of (+)-alpha-Pinene Binding to Human Cytochrome P450 2B6.
15	PDB:1z11A	0.876	0.937	2.247E-35	467	0.323	0.347	1z11A.pdb.gz	Structures of human microsomal cytochrome P450 2A6 complexed with coumarin and methoxsalen
16	PDB:4nz2A	0.855	0.920	4.712E-35	464	0.337	0.364	4nz2A.pdb.gz	Structure-based ligand design to overcome CYP inhibition in drug discovery projects.
17	PDB:3t3zA	0.870	0.937	9.006E-35	464	0.331	0.358	3t3zA.pdb.gz	Structural comparison of cytochromes P450 2A6, 2A13, and 2E1 with pilocarpine.
18	PDB:4gqsA	0.867	0.934	1.035E-34	464	0.331	0.358	4gqsA.pdb.gz	Structural Characterization of Human Cytochrome P450 2C19: ACTIVE SITE DIFFERENCES BETWEEN P450s 2C8, 2C9, AND 2C19.
19	PDB:6b82B	0.865	0.919	1.022E-31	470	0.301	0.321	6b82B.pdb.gz	Inherent steroid 17 alpha ,20-lyase activity in defunct cytochrome P450 17A enzymes.
20	PDB:4i8vA	0.870	0.912	2.270E-30	477	0.259	0.273	4i8vA.pdb.gz	Human Cytochrome P450 1A1 Structure and Utility in Understanding Drug and Xenobiotic Metabolism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0G3	0.0	887	501	0.878	0.878	A0A8I6A0G3_RAT Cytochrome P450, family 2, subfamily r, polypeptide 1 OS=Rattus norvegicus OX=10116 GN=Cyp2r1 PE=3 SV=1
2	F6P2A1	0.0	707	506	0.675	0.668	F6P2A1_DANRE Cytochrome P450, family 2, subfamily R, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp2r1 PE=3 SV=1
3	F7FAJ1	0.0	774	452	0.774	0.858	F7FAJ1_RAT Cytochrome P450, family 2, subfamily r, polypeptide 1 OS=Rattus norvegicus OX=10116 GN=Cyp2r1 PE=3 SV=3
4	Q6VVW9	0.0	889	501	0.848	0.848	CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus OX=10090 GN=Cyp2r1 PE=1 SV=1
5	Q6VVX0	0.0	1041	501	1.000	1.000	CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens OX=9606 GN=CYP2R1 PE=1 SV=1
6	P51589	1.84e-138	410	502	0.427	0.426	CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP2J2 PE=1 SV=2
7	Q9QXF7	6.07e-135	401	501	0.427	0.427	CP2J4_RAT Cytochrome P450 2J4 OS=Rattus norvegicus OX=10116 GN=CYP2J4 PE=1 SV=1
8	Q5BKA2	8.45e-134	398	501	0.425	0.425	Q5BKA2_RAT Cytochrome P450, family 2, subfamily j, polypeptide 4 OS=Rattus norvegicus OX=10116 GN=Cyp2j4 PE=3 SV=1
9	O54750	3.15e-130	389	501	0.417	0.417	CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cyp2j6 PE=2 SV=2
10	O54749	3.14e-128	384	501	0.403	0.403	CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus OX=10090 GN=Cyp2j5 PE=1 SV=1
11	Q7Z449	3.33e-126	380	544	0.393	0.362	CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens OX=9606 GN=CYP2U1 PE=1 SV=1
12	Q924D1	8.22e-121	365	502	0.389	0.388	Q924D1_MOUSE Cytochrome P450 CYP2J9 OS=Mus musculus OX=10090 GN=Cyp2j9 PE=1 SV=1
13	A0A0G2K921	5.41e-120	360	432	0.371	0.431	A0A0G2K921_RAT Cytochrome P450, family 2, subfamily j, polypeptide 4 OS=Rattus norvegicus OX=10116 GN=Cyp2j3 PE=1 SV=2
14	Q9DEW9	9.84e-120	362	490	0.391	0.400	Q9DEW9_ICTPU Cytochrome P450 OS=Ictalurus punctatus OX=7998 GN=LOC100335049 PE=2 SV=1
15	Q9CRQ9	4.64e-119	362	529	0.387	0.367	Q9CRQ9_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cyp2j9 PE=2 SV=1
16	Q64680	2.41e-115	351	500	0.407	0.408	CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus OX=10116 GN=Cyp2d4 PE=2 SV=1
17	Q91W87	2.29e-113	346	500	0.399	0.400	Q91W87_MOUSE Cytochrome P450 OS=Mus musculus OX=10090 GN=Cyp2d22 PE=2 SV=1
18	O35293	7.72e-113	344	491	0.365	0.373	CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus OX=10116 GN=Cyp2f2 PE=2 SV=1
19	Q9JKY7	1.11e-112	344	500	0.397	0.398	Q9JKY7_MOUSE Cytochrome P450 OS=Mus musculus OX=10090 GN=Cyp2d22 PE=1 SV=1
20	P33267	2.67e-112	343	491	0.361	0.369	CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus OX=10090 GN=Cyp2f2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	3.3e-118	407.0	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334592

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228606	0.968	25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
2	9606.ENSP00000216862	0.952	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
3	9606.ENSP00000421725	0.894	Vitamin D-binding protein
4	9606.ENSP00000347717	0.893	7-dehydrocholesterol reductase
5	9606.ENSP00000326424	0.859	Glutamine-dependent NAD(+) synthetase
6	9606.ENSP00000447173	0.852	Vitamin D3 receptor
7	9606.ENSP00000419970	0.843	NADPH--cytochrome P450 reductase
8	9606.ENSP00000282091	0.684	Parathyroid hormone
9	9606.ENSP00000454804	0.667	Agouti-signaling protein
10	9606.ENSP00000370343	0.650	Interferon regulatory factor 4
11	9606.ENSP00000419126	0.610	Uncharacterized protein C10orf88
12	9606.ENSP00000261597	0.603	Kinetochore protein NDC80 homolog
13	9606.ENSP00000237837	0.600	Fibroblast growth factor 23
14	9606.ENSP00000282096	0.592	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
15	9606.ENSP00000416750	0.588	Serine/threonine-protein kinase 33
16	9606.ENSP00000296589	0.579	Membrane-associated transporter protein
17	9606.ENSP00000414359	0.579	Proteasome subunit alpha type-1
18	9606.ENSP00000249923	0.564	Coatomer subunit beta
19	9606.ENSP00000260970	0.564	Peptidyl-prolyl cis-trans isomerase G
20	9606.ENSP00000356959	0.561	Nuclear receptor subfamily 1 group I member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004497	1.000	monooxygenase activity
GO:0016705	0.999	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005488	0.964	binding
GO:0005515	0.556	protein binding
GO:0008395	0.378	steroid hydroxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0009987	0.986	cellular process
GO:0044237	0.981	cellular metabolic process
GO:0006629	0.917	lipid metabolic process
GO:0008202	0.879	steroid metabolic process
GO:0006775	0.870	fat-soluble vitamin metabolic process
GO:1901615	0.757	organic hydroxy compound metabolic process
GO:0050896	0.664	response to stimulus
GO:0065007	0.508	biological regulation
GO:0042221	0.504	response to chemical
GO:1901576	0.448	organic substance biosynthetic process
GO:0008610	0.303	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.986	endomembrane system
GO:0016020	0.972	membrane
GO:0005737	0.964	cytoplasm
GO:0031090	0.909	organelle membrane
GO:0005783	0.804	endoplasmic reticulum
GO:0042175	0.743	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.739	endoplasmic reticulum subcompartment
GO:0005789	0.731	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	0.999	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
RHEA:43836	0.378	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)

[back to server]