StarFunc result for job id Q6W2J9

User Input

>input (1755 residues)
MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDAST
AHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNP
EMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLN
INGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTN
GERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVD
SHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKH
YARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGS
EIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQR
SSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQ
PPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPY
PAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDAL
GLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVP
TDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPF
LEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPS
KLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAM
MRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERC
EYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSG
DSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIEL
TGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAK
QQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLT
GEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSP
QETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCA
LHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLAT
YSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANP
PGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSS
VEWLHPSDLASDNYW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6W2J9	1.000	1.000	0.000	1755	1.000	1.000	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
2	AFDB:Q8CGN4	0.150	0.150	0.000	1759	0.888	0.886	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
3	AFDB:F1RCL8	0.138	0.136	9.941E-73	1796	0.395	0.386	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
4	AFDB:Q5H9F3	0.124	0.127	6.787E-33	1711	0.231	0.237	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
5	AFDB:Q8IQT4	0.081	0.068	1.804E-20	2133	0.198	0.163	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
6	PDB:2dvwA	0.066	0.491	8.625E-8	229	0.018	0.140	2dvwA.pdb.gz
7	PDB:7df7B	0.062	0.853	1.133E-7	119	0.021	0.311	7df7B.pdb.gz
8	PDB:3ehqA	0.063	0.596	1.572E-7	182	0.020	0.192	3ehqA.pdb.gz
9	PDB:5vkqA	0.067	0.079	2.434E-7	1499	0.022	0.025	5vkqA.pdb.gz
10	PDB:8cs9A	0.070	0.152	2.434E-7	796	0.023	0.052	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
11	PDB:4oauC	0.068	0.170	4.201E-7	692	0.023	0.059	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:6jd6B	0.070	0.583	8.089E-7	192	0.022	0.198	6jd6B.pdb.gz
13	PDB:6mwqA	0.067	0.237	1.835E-6	493	0.027	0.095	6mwqA.pdb.gz
14	PDB:1wg0A	0.072	0.502	2.840E-6	243	0.021	0.148	1wg0A.pdb.gz
15	PDB:6v9hC	0.055	0.338	1.310E-5	270	0.018	0.119	6v9hC.pdb.gz
16	AFDB:A0A140LI88	0.076	0.072	3.149E-4	1857	0.144	0.136	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
17	AFDB:X2JEM2	0.056	0.047	8.412E-4	2326	0.124	0.093	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
18	AFDB:Q9NZM4	0.028	0.031	1.452E-3	1560	0.135	0.152	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
19	AFDB:Q9NYF8	0.028	0.041	1.908E-3	920	0.075	0.143	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
20	AFDB:Q76E23	0.041	0.042	5.686E-3	1727	0.134	0.136	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A564	0.0	816	411	0.228	0.973	A1A564_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
2	F1RCL8	0.0	691	1796	0.247	0.242	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
3	H7BYY2	0.0	2603	1287	0.733	1.000	H7BYY2_HUMAN BCL-6 corepressor (Fragment) OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
4	H7BZ37	0.0	3406	1659	0.945	1.000	H7BZ37_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=2
5	H7C231	0.0	3556	1737	0.990	1.000	H7C231_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=3
6	H7C2V9	0.0	3445	1690	0.961	0.998	H7C2V9_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=2
7	Q6W2J8	0.0	660	1777	0.240	0.237	Q6W2J8_DANRE BCL-6 corepressor OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
8	Q6W2J9	0.0	3606	1755	1.000	1.000	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
9	Q8CGN4	0.0	3175	1759	0.889	0.887	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
10	A0A5F9ZGX7	2.39e-148	456	221	0.126	1.000	A0A5F9ZGX7_HUMAN BCL-6 corepressor (Fragment) OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
11	Q5H9F3	1.52e-114	404	1785	0.119	0.117	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
12	Q8IQT4	4.86e-41	169	2133	0.046	0.038	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
13	Q8MT12	7.67e-41	160	453	0.046	0.177	Q8MT12_DROME SD21394p OS=Drosophila melanogaster OX=7227 GN=CG14073 PE=2 SV=1
14	Q59GC3	1.17e-20	99.4	439	0.035	0.141	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
15	Q6UB99	4.61e-20	100	2663	0.035	0.023	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
16	E9Q4F7	4.72e-20	100	2643	0.036	0.024	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
17	P40480	1.06e-16	89.0	1083	0.028	0.046	HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOS4 PE=1 SV=1
18	A0A140LI88	1.42e-15	85.5	1857	0.027	0.025	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
19	A0AVN2	2.93e-15	84.0	777	0.031	0.069	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
20	Q99728	4.52e-15	83.6	777	0.031	0.069	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.1e-06	40.0	Ankyrin repeat
2	PF12796 Ank_2	2.5e-12	58.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.3e-11	53.2	Ankyrin repeat
4	PF13637 Ank_4	3.6e-08	45.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2e-08	45.6	Ankyrin repeats (many copies)
6	PF15808 BCOR	7.4e-78	273.2	BCL-6 co-repressor, non-ankyrin-repeat region
7	PF12388 Peptidase_M57	6.4e+02	11.4	Dual-action HEIGH metallo-peptidase
8	PF16553 PUFD	3.1e-52	186.9	BCORL-PCGF1-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367705

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233630	0.999	Polycomb group RING finger protein 1
2	9606.ENSP00000369695	0.999	Protein AF-9
3	9606.ENSP00000384371	0.999	B-cell lymphoma 6 protein
4	9606.ENSP00000356480	0.998	E3 ubiquitin-protein ligase RING2
5	9606.ENSP00000366271	0.998	Lysine-specific demethylase 2B
6	9606.ENSP00000419494	0.991	RING1 and YY1-binding protein
7	9606.ENSP00000363787	0.972	E3 ubiquitin-protein ligase RING1
8	9606.ENSP00000328004	0.966	YY1 associated factor 2, isoform CRA_d
9	9606.ENSP00000225983	0.927	Histone deacetylase 5
10	9606.ENSP00000212015	0.910	NAD-dependent protein deacetylase sirtuin-1
11	9606.ENSP00000269385	0.873	Chromobox protein homolog 8
12	9606.ENSP00000354724	0.828	Polycomb group RING finger protein 3
13	9606.ENSP00000231487	0.826	S-phase kinase-associated protein 1
14	9606.ENSP00000417763	0.818	N-alpha-acetyltransferase 10
15	9606.ENSP00000345793	0.812	Zinc finger CCCH domain-containing protein 7B
16	9606.ENSP00000384018	0.778	Nuclear receptor corepressor 2
17	9606.ENSP00000365210	0.763	G2/mitotic-specific cyclin-B3
18	9606.ENSP00000303015	0.733	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
19	9606.ENSP00000343535	0.721	Ubiquitin carboxyl-terminal hydrolase 7
20	9606.ENSP00000364839	0.720	Putative Polycomb group protein ASXL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003712	0.998	transcription coregulator activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0003714	0.994	transcription corepressor activity
GO:0003824	0.980	catalytic activity
GO:0008134	0.954	transcription factor binding
GO:0140096	0.941	catalytic activity, acting on a protein
GO:0140297	0.906	DNA-binding transcription factor binding
GO:0016740	0.835	transferase activity
GO:0019899	0.824	enzyme binding
GO:0042826	0.768	histone deacetylase binding
GO:0019787	0.743	ubiquitin-like protein transferase activity
GO:0031072	0.708	heat shock protein binding
GO:0004842	0.701	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000122	0.977	negative regulation of transcription by RNA polymerase II
GO:0009987	0.969	cellular process
GO:0048856	0.946	anatomical structure development
GO:0032501	0.925	multicellular organismal process
GO:0007275	0.921	multicellular organism development
GO:0016043	0.786	cellular component organization
GO:0051239	0.494	regulation of multicellular organismal process
GO:0006325	0.484	chromatin organization
GO:0051246	0.408	regulation of protein metabolic process
GO:0048518	0.374	positive regulation of biological process
GO:0050793	0.335	regulation of developmental process
GO:0048522	0.301	positive regulation of cellular process
GO:0008152	0.300	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0032991	0.836	protein-containing complex
GO:0140261	0.380	BCOR complex
GO:0005737	0.377	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.835	Transferases.

[back to server]