StarFunc result for job id Q6W4X9

User Input

>input (2439 residues)
MVQRWLLLSCCGALLSAGLANTSYTSPGLQRLKDSPQTAPDKGQCSTWGAGHFSTFDHHV
YDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEAIISVKDIGV
ISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFD
GKVTNEFVSEEGKFLEPHKFAALQKLDDPGEICTFQDIPSTHVRQAQHARICTQLLTLVA
PECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRSPGLCSVG
QCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV
LHGAMYAPGEVTIAACQTCRCTLGRWVCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT
YILLQSPQLPEDGALMAVYDKSGVSHSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDT
TDDFTTSMGIAEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLLRTGT
VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACSLRGVLLWGWRSSVDNC
TIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQ
CPCILEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENK
FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA
ELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCG
VNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLGVTPG
ALSLVVDISIPGRYNLTLIWNRHMTILIRIARASQDPLCGLCGNFNGNMKDDFETRSRYV
ASSELELVNSWKESPLCGDVSFVTDPCSLNAFRRSWAERKCSVINSQTFATCHSKVYHLP
YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPAFCPIYCGFYNTHTQD
GHGEYQYTQEANCTWHYQPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEEGVCVPCMPPT
TPQPPTTPQLPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLT
SSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTST
AQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQP
TRPTATETTQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPE
TTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPTTLKATGSTHTAP
PITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTPTSTTTITPNPTSTRTRTPVAH
TNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQTTLPTHVPPFS
TSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHTAPTMTLTTSGTSQ
ALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSF
STAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTH
SPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTTLPTHVPSFSTSLVTPSTHTVIIPTH
TQMATSASIHSMPTGTIPPPTTIKATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPY
HTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSS
TGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHS
TPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSS
RPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVG
TSSSFVSAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPF
TLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRV
PTSGFVSLTSGVTGIPTSPVTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGT
PTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDARCSCCRPLH
SYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6W4X9	1.000	1.000	0.000	2439	1.000	1.000	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
2	PDB:6z3mc	0.042	0.484	1.074E-3	158	0.009	0.146	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
3	PDB:7dvq3	0.037	0.055	3.812E-3	1193	0.022	0.045	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
4	PDB:5hk5F	0.029	0.455	4.218E-3	129	0.007	0.140	5hk5F.pdb.gz
5	PDB:4my2A	0.027	0.126	9.023E-3	474	0.011	0.057	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
6	PDB:3o2yA	0.022	0.182	2.363E-2	160	0.007	0.113	3o2yA.pdb.gz
7	PDB:5hxbY	0.035	0.052	3.045E-2	1080	0.021	0.048	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
8	PDB:7mq8LJ	0.030	0.095	3.370E-2	469	0.014	0.075	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:4gh7A	0.020	0.150	4.568E-2	174	0.006	0.086	4gh7A.pdb.gz
10	PDB:6urgA	0.042	0.062	5.318E-2	1202	0.025	0.052	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
11	PDB:7lpsA	0.040	0.072	5.594E-2	781	0.036	0.114	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
12	AFDB:F1R8J2	0.040	0.045	2.728E-1	2014	0.082	0.100	F1R8J2.pdb.gz
13	AFDB:A0A0B4K6Y7	0.032	0.033	5.012E-1	2395	0.078	0.079	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
14	AFDB:F4I1T7	0.032	0.038	1.186	1819	0.099	0.133	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
15	AFDB:Q86YC2	0.026	0.040	1.453	1186	0.056	0.115	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1
16	AFDB:Q95TJ2	0.024	0.038	1.872	1261	0.067	0.129	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
17	AFDB:Q3U0P1	0.023	0.038	2.072	1104	0.059	0.130	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
18	AFDB:A0A1D8PGF8	0.023	0.033	2.808	1409	0.112	0.194	A0A1D8PGF8.pdb.gz	A0A1D8PGF8_CANAL Msb2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB2 PE=4 SV=1
19	AFDB:Q9VPG1	0.028	0.030	4.431	2284	0.130	0.139	Q9VPG1.pdb.gz	Q9VPG1_DROME Zye OS=Drosophila melanogaster OX=7227 GN=zye PE=4 SV=1
20	AFDB:Q6FTP4	0.031	0.072	4.662	722	0.048	0.163	Q6FTP4.pdb.gz	Q6FTP4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G00902g PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1Y4	0.0	869	3586	0.198	0.134	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	A0A0G2K8X5	0.0	872	3922	0.198	0.123	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
3	E9PWB6	0.0	853	2751	0.197	0.174	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
4	E9Q5I3	0.0	892	4800	0.195	0.099	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
5	E9QAQ8	0.0	875	3455	0.197	0.139	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
6	F1NBL0	0.0	1701	1185	0.307	0.632	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
7	P98088	0.0	868	5654	0.198	0.085	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
8	Q02817	0.0	855	5179	0.191	0.090	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
9	Q62635	0.0	824	1513	0.194	0.313	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
10	Q6PZE0	0.0	674	7524	0.157	0.051	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
11	Q6W4X9	0.0	4854	2439	1.000	1.000	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
12	Q7Z5P9	0.0	664	8384	0.162	0.047	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
13	Q80Z19	0.0	831	2680	0.193	0.175	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
14	Q8BYW0	0.0	839	1477	0.194	0.321	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
15	Q8K1G6	0.0	891	4782	0.195	0.100	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
16	Q98UI9	0.0	725	2108	0.171	0.198	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
17	Q9ESP3	0.0	866	1851	0.198	0.260	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
18	Q9HC84	0.0	868	5762	0.192	0.081	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
19	Q8CIZ8	1.22e-140	495	2813	0.146	0.126	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
20	E7F9Z1	2.97e-138	488	2812	0.143	0.124	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	6.8e-35	130.5	C8 domain
2	PF01826 TIL	3.9e-14	63.9	Trypsin Inhibitor like cysteine rich domain
3	PF00093 VWC	1.6	20.4	von Willebrand factor type C domain
4	PF00094 VWD	1.5e-76	267.5	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417498	0.986	Mucin-4
2	9606.ENSP00000484824	0.985	Mucin-1
3	9606.ENSP00000407422	0.979	Mucin-7
4	9606.ENSP00000381008	0.977	Mucin-16
5	9606.ENSP00000302716	0.975	Mucin-17
6	9606.ENSP00000441929	0.975	Mucin-12
7	9606.ENSP00000236709	0.974	Alpha-1,4-N-acetylglucosaminyltransferase
8	9606.ENSP00000485028	0.974	Mucin-13
9	9606.ENSP00000368771	0.972	Mucin-3A
10	9606.ENSP00000414350	0.972	Mucin-20
11	9606.ENSP00000416753	0.972	Mucin-15
12	9606.ENSP00000365473	0.965	Mucin-21
13	9606.ENSP00000379377	0.936	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
14	9606.ENSP00000291526	0.935	Trefoil factor 2
15	9606.ENSP00000389176	0.933	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
16	9606.ENSP00000484640	0.932	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
17	9606.ENSP00000317027	0.929	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
18	9606.ENSP00000415454	0.929	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
19	9606.ENSP00000436812	0.929	Mucin-5B
20	9606.ENSP00000485659	0.928	Mucin-5AC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050896	0.929	response to stimulus
GO:0032501	0.899	multicellular organismal process
GO:0065007	0.876	biological regulation
GO:0050794	0.801	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0005794	0.997	Golgi apparatus
GO:0016020	0.996	membrane
GO:0070013	0.993	intracellular organelle lumen
GO:0005886	0.991	plasma membrane
GO:0005796	0.908	Golgi lumen
GO:0005576	0.882	extracellular region
GO:0005615	0.697	extracellular space
GO:0031090	0.488	organelle membrane
GO:0031981	0.332	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]