StarFunc result for job id Q6WBX8

User Input

>input (426 residues)
MLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPVFFQ
HYQWSALVKMSENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCKVVI
QFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVTLAV
TPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFSEAT
HAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDLIEK
KAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESSVSN
TEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNGSDA
KYFCII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6WBX8	1.000	1.000	7.923E-83	426	1.000	1.000	Q6WBX8.pdb.gz	RAD9B_HUMAN Cell cycle checkpoint control protein RAD9B OS=Homo sapiens OX=9606 GN=RAD9B PE=1 SV=2
2	PDB:7z6hA	0.547	0.923	4.623E-28	247	0.258	0.445	7z6hA.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
3	AFDB:Q4QF86	0.538	0.286	8.194E-19	821	0.155	0.080	Q4QF86.pdb.gz	Q4QF86_LEIMA DNA repair protein Rad9 OS=Leishmania major OX=5664 GN=LMJF_15_0980 PE=4 SV=1
4	PDB:7st9G	0.532	0.657	5.923E-18	340	0.110	0.138	7st9G.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
5	PDB:3a2fB	0.476	0.778	9.342E-17	247	0.087	0.150	3a2fB.pdb.gz
6	PDB:3lx2A	0.510	0.843	3.930E-16	247	0.082	0.142	3lx2A.pdb.gz
7	PDB:7sgzH	0.532	0.822	2.773E-15	266	0.103	0.165	7sgzH.pdb.gz	DNA is loaded through the 9-1-1 DNA checkpoint clamp in the opposite direction of the PCNA clamp.
8	PDB:6t8hC	0.471	0.775	2.937E-15	246	0.094	0.163	6t8hC.pdb.gz	Structural basis for the increased processivity of D-family DNA polymerases in complex with PCNA.
9	PDB:6qh1B	0.456	0.740	7.365E-15	251	0.082	0.139	6qh1B.pdb.gz	The structure of Schizosaccharomyces pombe PCNA in complex with an Spd1 derived peptide
10	PDB:6kncC	0.469	0.761	1.386E-14	249	0.096	0.165	6kncC.pdb.gz	Two conformations of DNA polymerase D-PCNA-DNA, an archaeal replisome complex, revealed by cryo-electron microscopy.
11	PDB:1vyjG	0.507	0.794	2.607E-14	260	0.082	0.135	1vyjG.pdb.gz	Structural and Biochemical Studies of Human Proliferating Cell Nuclear Antigen Complexes Provide a Rationale for Cyclin Association and Inhibitor Design
12	PDB:7st9F	0.511	0.716	6.174E-14	293	0.099	0.143	7st9F.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
13	AFDB:Q3UJB9	0.088	0.041	7.690E-3	1406	0.115	0.035	Q3UJB9.pdb.gz	EDC4_MOUSE Enhancer of mRNA-decapping protein 4 OS=Mus musculus OX=10090 GN=Edc4 PE=1 SV=2
14	AFDB:A0A024R2U5	0.083	0.081	5.426E-2	440	0.096	0.093	A0A024R2U5.pdb.gz
15	AFDB:Q57WH0	0.090	0.047	5.747E-2	1241	0.115	0.039	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
16	AFDB:Q80U93	0.090	0.031	7.232E-2	2085	0.113	0.023	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
17	AFDB:I2HAJ6	0.068	0.026	1.021E-1	1725	0.115	0.028	I2HAJ6.pdb.gz	I2HAJ6_CAEEL Neurexin-3-beta OS=Caenorhabditis elegans OX=6239 GN=nrx-1 PE=4 SV=1
18	AFDB:P01042	0.093	0.071	1.021E-1	644	0.115	0.076	P01042.pdb.gz	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2
19	AFDB:P40189	0.081	0.052	1.081E-1	918	0.129	0.060	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
20	AFDB:P28006	0.102	0.067	1.441E-1	793	0.115	0.062	P28006.pdb.gz	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6WBX8	0.0	879	426	1.000	1.000	RAD9B_HUMAN Cell cycle checkpoint control protein RAD9B OS=Homo sapiens OX=9606 GN=RAD9B PE=1 SV=2
2	Q9Z0F6	3.04e-73	236	389	0.331	0.362	RAD9A_MOUSE Cell cycle checkpoint control protein RAD9A OS=Mus musculus OX=10090 GN=Rad9a PE=1 SV=1
3	Q99638	1.50e-71	232	391	0.319	0.348	RAD9A_HUMAN Cell cycle checkpoint control protein RAD9A OS=Homo sapiens OX=9606 GN=RAD9A PE=1 SV=1
4	Q76F79	1.57e-71	231	376	0.319	0.362	Q76F79_CHICK RAD9 checkpoint clamp component A OS=Gallus gallus OX=9031 GN=rad9 PE=2 SV=1
5	F5H4F1	1.18e-58	194	247	0.242	0.417	F5H4F1_HUMAN RAD9 checkpoint clamp component A (Fragment) OS=Homo sapiens OX=9606 GN=RAD9A PE=1 SV=1
6	P26306	5.25e-24	105	426	0.188	0.188	RAD9_SCHPO DNA repair protein rad9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad9 PE=1 SV=1
7	O96533	2.52e-23	103	456	0.162	0.151	O96533_DROME Cell cycle checkpoint control protein OS=Drosophila melanogaster OX=7227 GN=Rad9 PE=2 SV=1
8	A8JNV5	3.89e-23	103	456	0.162	0.151	A8JNV5_DROME Cell cycle checkpoint control protein OS=Drosophila melanogaster OX=7227 GN=Rad9 PE=3 SV=2
9	F4J7B7	3.06e-14	76.6	456	0.221	0.206	F4J7B7_ARATH Cell cycle checkpoint control protein family OS=Arabidopsis thaliana OX=3702 GN=RAD9 PE=1 SV=1
10	P47980	0.62	34.7	436	0.045	0.044	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
11	Q80W93	3.0	32.7	5154	0.040	0.003	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
12	Q9ZW35	6.3	31.2	264	0.052	0.083	PCNA2_ARATH Proliferating cell nuclear antigen 2 OS=Arabidopsis thaliana OX=3702 GN=PCNA2 PE=1 SV=1
13	Q4G0P3	7.3	31.6	5121	0.038	0.003	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
14	Q6P2K8	9.5	31.2	640	0.042	0.028	Q6P2K8_MOUSE Cep192 protein OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04139 Rad9	1.5e-87	304.8	Rad9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258774	0.993	Checkpoint protein HUS1
2	9606.ENSP00000370293	0.984	Checkpoint protein HUS1B
3	9606.ENSP00000371469	0.977	Cell cycle checkpoint protein RAD1
4	9606.ENSP00000260810	0.958	DNA topoisomerase 2-binding protein 1
5	9606.ENSP00000426191	0.958	Cell cycle checkpoint protein RAD17
6	9606.ENSP00000310520	0.937	DNA repair endonuclease XPF
7	9606.ENSP00000311360	0.925	Cell cycle checkpoint control protein RAD9A
8	9606.ENSP00000343741	0.925	Serine/threonine-protein kinase ATR
9	9606.ENSP00000013807	0.907	DNA excision repair protein ERCC-1
10	9606.ENSP00000269305	0.906	Cellular tumor antigen p53
11	9606.ENSP00000278616	0.850	Serine-protein kinase ATM
12	9606.ENSP00000369497	0.830	Breast cancer type 2 susceptibility protein
13	9606.ENSP00000372088	0.815	DNA repair protein RAD51 homolog 1
14	9606.ENSP00000388648	0.813	Serine/threonine-protein kinase Chk1
15	9606.ENSP00000310356	0.805	RecQ-mediated genome instability protein 2
16	9606.ENSP00000355506	0.798	Exonuclease 1
17	9606.ENSP00000376272	0.782	Replication factor C subunit 4
18	9606.ENSP00000419471	0.777	DNA repair protein RAD51 homolog 2
19	9606.ENSP00000055077	0.775	Replication factor C subunit 2
20	9606.ENSP00000347232	0.774	Bloom syndrome protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0000075	0.994	cell cycle checkpoint signaling
GO:0008152	0.988	metabolic process
GO:0006974	0.983	cellular response to DNA damage stimulus
GO:0031570	0.982	DNA integrity checkpoint signaling
GO:0044238	0.969	primary metabolic process
GO:0071704	0.965	organic substance metabolic process
GO:0044237	0.961	cellular metabolic process
GO:0006807	0.953	nitrogen compound metabolic process
GO:0043170	0.949	macromolecule metabolic process
GO:0000077	0.943	DNA damage checkpoint signaling
GO:0090304	0.936	nucleic acid metabolic process
GO:0006259	0.930	DNA metabolic process
GO:0007049	0.912	cell cycle
GO:0006281	0.836	DNA repair
GO:0022402	0.672	cell cycle process
GO:0019222	0.545	regulation of metabolic process
GO:0060255	0.529	regulation of macromolecule metabolic process
GO:0080090	0.524	regulation of primary metabolic process
GO:0031323	0.520	regulation of cellular metabolic process
GO:0051171	0.519	regulation of nitrogen compound metabolic process
GO:0048518	0.516	positive regulation of biological process
GO:0010212	0.499	response to ionizing radiation
GO:0071478	0.467	cellular response to radiation
GO:0048583	0.453	regulation of response to stimulus
GO:0080134	0.440	regulation of response to stress
GO:0048522	0.430	positive regulation of cellular process
GO:2001020	0.414	regulation of response to DNA damage stimulus
GO:0019219	0.303	regulation of nucleobase-containing compound metabolic process
GO:0071479	0.301	cellular response to ionizing radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0005694	0.928	chromosome
GO:0005737	0.647	cytoplasm
GO:0032991	0.413	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]