StarFunc result for job id Q6WCQ1

User Input

>input (1025 residues)
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQAKPIYGGWLLLAPDGTDFD
NPVHRSRKWQRRFFILYEHGLLRYALDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLC
ILTPEKEHFIRAETKEIVSGWLEMLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKVAVTSS
SSSSSSSSSIPSAEKVPTTKSTLWQEEMRTKDQPDGSSLSPAQSPSQSQPPAASSLREPG
LESKEEESAMSSDRMDCGRKVRVESGYFSLEKTKQDLKAEEQQLPPPLSPPSPSTPNHRR
SQVIEKFEALDIEKAEHMETNAVGPSPSSDTRQGRSEKRAFPRKRDFTNEAPPAPLPDAS
ASPLSPHRRAKSLDRRSTEPSVTPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRD
SVAEEAADLDGEIDLSACYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMK
HVHPTTAPDVTSSLPEEKNKSSCSFETCPRPTEKQEAELGEPDPEQKRSRARERRREGRS
KTFDWAEFRPIQQALAQERVGGVGPADTHEPLRPEAEPGELERERARRREERRKRFGMLD
ATDGPGTEDAALRMEVDRSPGLPMSDLKTHNVHVEIEQRWHQVETTPLREEKQVPIAPVH
LSSEDGGDRLSTHELTSLLEKELEQSQKEASDLLEQNRLLQDQLRVALGREQSAREGYVL
QATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHR
EEMERELEKSQRSQISSVNSDVEALRRQYLEELQSVQRELEVLSEQYSQKCLENAHLAQA
LEAERQALRQCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGKDAY
ELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDIS
RLKEQLKAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKDRSCVTRQLRNIRSKSVIEQ
VSWDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ERE6	0.245	0.244	0.000	1029	0.911	0.908	Q9ERE6.pdb.gz	MPRIP_RAT Myosin phosphatase Rho-interacting protein OS=Rattus norvegicus OX=10116 GN=Mprip PE=1 SV=1
2	AFDB:Q8BSM5	0.104	0.175	8.093E-9	595	0.109	0.188	Q8BSM5.pdb.gz	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
3	AFDB:F1Q7S5	0.098	0.131	3.068E-8	740	0.118	0.164	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
4	PDB:3ljuX	0.090	0.237	1.798E-7	373	0.046	0.126	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
5	AFDB:Q9UQC2	0.098	0.143	2.774E-7	676	0.124	0.188	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
6	AFDB:F6NTT0	0.096	0.135	4.409E-7	712	0.121	0.174	F6NTT0.pdb.gz	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
7	AFDB:D3ZAL7	0.099	0.142	4.672E-7	693	0.111	0.165	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
8	AFDB:C6JUQ2	0.095	0.132	6.242E-7	721	0.093	0.132	C6JUQ2.pdb.gz	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
9	AFDB:Q9QYY0	0.094	0.134	8.837E-7	695	0.083	0.122	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
10	PDB:4mk0A	0.087	0.139	1.934E-6	631	0.014	0.022	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
11	AFDB:Q9UPN4	0.076	0.072	2.233E-6	1083	0.139	0.131	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
12	AFDB:A1Z7Z9	0.091	0.083	2.507E-6	1134	0.131	0.118	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
13	PDB:6bbpA	0.087	0.169	1.100E-5	520	0.023	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:3uzsA	0.089	0.143	2.081E-5	609	0.015	0.025	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
15	PDB:7rx9A	0.093	0.209	2.081E-5	432	0.027	0.065	7rx9A.pdb.gz
16	PDB:3pvuA	0.084	0.138	3.122E-5	609	0.014	0.023	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:6hhgA	0.080	0.203	7.444E-5	386	0.023	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:4mt6A	0.094	0.223	9.386E-5	389	0.024	0.064	4mt6A.pdb.gz
19	PDB:4uudC	0.084	0.627	1.775E-4	113	0.020	0.186	4uudC.pdb.gz
20	PDB:4iapA	0.071	0.274	2.238E-4	256	0.018	0.070	4iapA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494BZV2	0.0	585	2425	0.293	0.124	A0A494BZV2_HUMAN Myosin phosphatase Rho interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
2	H0Y2S9	0.0	589	1794	0.293	0.167	H0Y2S9_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
3	H0Y7E2	0.0	608	1091	0.300	0.282	H0Y7E2_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
4	J3KSW8	0.0	1654	844	0.803	0.975	J3KSW8_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
5	Q6WCQ1	0.0	2110	1025	1.000	1.000	MPRIP_HUMAN Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3
6	Q9ERE6	0.0	1764	1029	0.901	0.898	MPRIP_RAT Myosin phosphatase Rho-interacting protein OS=Rattus norvegicus OX=10116 GN=Mprip PE=1 SV=1
7	H7C3G6	6.73e-167	492	277	0.249	0.921	H7C3G6_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=2
8	Q9H2D6	4.27e-132	444	2365	0.267	0.116	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
9	Q99KW3	9.10e-128	430	2014	0.260	0.133	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
10	J3QRL2	4.21e-78	255	181	0.125	0.707	J3QRL2_HUMAN Myosin phosphatase Rho interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=1
11	Q9Y2H5	4.01e-07	56.6	1048	0.062	0.061	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
12	Q6ZPK1	2.38e-06	54.3	1205	0.040	0.034	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
13	A0A0N4SUU0	2.51e-06	54.3	956	0.040	0.043	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
14	E9Q6H8	2.60e-06	54.3	1269	0.040	0.032	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
15	A0A0N4SUV0	2.67e-06	53.5	525	0.040	0.078	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	A0A0N4SWD7	2.84e-06	53.9	1000	0.040	0.041	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
17	A0A0N4SW19	3.11e-06	53.5	531	0.040	0.077	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
18	B4DJX4	3.64e-06	53.5	977	0.040	0.042	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
19	A0A1B0GTN9	3.85e-06	53.5	1192	0.042	0.036	A0A1B0GTN9_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
20	Q9HAU0	4.03e-06	53.5	1116	0.040	0.037	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	2.5e-24	97.1	PH domain
2	PF15413 PH_11	68	15.4	Pleckstrin homology domain
3	PF01023 S_100	6.2e+02	11.4	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379156

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.973	Transforming protein RhoA
2	9606.ENSP00000389168	0.961	Protein phosphatase 1 regulatory subunit 12A
3	9606.ENSP00000381412	0.914	Calcium/calmodulin-dependent protein kinase type II subunit alpha
4	9606.ENSP00000339740	0.904	Calcium/calmodulin-dependent protein kinase type II subunit delta
5	9606.ENSP00000371067	0.904	Tyrosine-protein kinase JAK2
6	9606.ENSP00000362329	0.903	Pyrophosphatase 1
7	9606.ENSP00000251849	0.902	RAF proto-oncogene serine/threonine-protein kinase
8	9606.ENSP00000290277	0.901	Serine/threonine-protein kinase A-Raf
9	9606.ENSP00000319060	0.901	Calcium/calmodulin-dependent protein kinase type II subunit gamma
10	9606.ENSP00000379098	0.901	Calcium/calmodulin-dependent protein kinase type II subunit beta
11	9606.ENSP00000263433	0.748	Protein phosphatase 1 regulatory subunit 12C
12	9606.ENSP00000363092	0.728	cGMP-dependent protein kinase 1
13	9606.ENSP00000362680	0.723	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000356125	0.716	NUAK family SNF1-like kinase 2
15	9606.ENSP00000340507	0.696	Transcription intermediary factor 1-alpha
16	9606.ENSP00000260130	0.691	Syntenin-1
17	9606.ENSP00000405738	0.682	Epithelial splicing regulatory protein 1
18	9606.ENSP00000357283	0.665	Prelamin-A/C
19	9606.ENSP00000268182	0.640	Ras GTPase-activating-like protein IQGAP1
20	9606.ENSP00000355094	0.639	Protein quaking

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	0.999	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051174	0.995	regulation of phosphorus metabolic process
GO:0065009	0.993	regulation of molecular function
GO:0019220	0.991	regulation of phosphate metabolic process
GO:0009987	0.990	cellular process
GO:0031399	0.989	regulation of protein modification process
GO:0048518	0.981	positive regulation of biological process
GO:0051179	0.971	localization
GO:0048522	0.971	positive regulation of cellular process
GO:0050790	0.954	regulation of catalytic activity
GO:0048523	0.947	negative regulation of cellular process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0051173	0.901	positive regulation of nitrogen compound metabolic process
GO:0031325	0.855	positive regulation of cellular metabolic process
GO:0045937	0.835	positive regulation of phosphate metabolic process
GO:0031401	0.834	positive regulation of protein modification process
GO:0035303	0.831	regulation of dephosphorylation
GO:0042325	0.819	regulation of phosphorylation
GO:0001932	0.814	regulation of protein phosphorylation
GO:0009892	0.670	negative regulation of metabolic process
GO:0051336	0.658	regulation of hydrolase activity
GO:0051248	0.657	negative regulation of protein metabolic process
GO:0001934	0.639	positive regulation of protein phosphorylation
GO:0033036	0.596	macromolecule localization
GO:0051235	0.589	maintenance of location
GO:0044092	0.540	negative regulation of molecular function
GO:0008104	0.498	protein localization
GO:0031324	0.488	negative regulation of cellular metabolic process
GO:0010563	0.420	negative regulation of phosphorus metabolic process
GO:0043086	0.417	negative regulation of catalytic activity
GO:0045936	0.407	negative regulation of phosphate metabolic process
GO:0031400	0.407	negative regulation of protein modification process
GO:0051346	0.399	negative regulation of hydrolase activity
GO:0048583	0.376	regulation of response to stimulus
GO:0050896	0.366	response to stimulus
GO:0035305	0.353	negative regulation of dephosphorylation
GO:0051651	0.351	maintenance of location in cell
GO:0010921	0.351	regulation of phosphatase activity
GO:0035304	0.351	regulation of protein dephosphorylation
GO:0035308	0.343	negative regulation of protein dephosphorylation
GO:0008152	0.308	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	1.000	actin cytoskeleton
GO:0005829	0.999	cytosol
GO:0030054	0.958	cell junction
GO:0071944	0.909	cell periphery
GO:0070161	0.908	anchoring junction
GO:0043231	0.815	intracellular membrane-bounded organelle
GO:0016020	0.617	membrane
GO:0070013	0.566	intracellular organelle lumen
GO:0030055	0.361	cell-substrate junction
GO:0005886	0.357	plasma membrane
GO:0032432	0.343	actin filament bundle
GO:0042641	0.336	actomyosin
GO:0001725	0.325	stress fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]