StarFunc result for job id Q6WN34

User Input

>input (429 residues)
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSEGAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQH
GEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASE
QSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPC
RHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA
SDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVT
ASPDKVTKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6WN34	1.000	1.000	1.416E-78	429	1.000	1.000	Q6WN34.pdb.gz	CRDL2_HUMAN Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1
2	AFDB:Q8VEA6	0.259	0.260	1.531E-56	426	0.725	0.730	Q8VEA6.pdb.gz	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
3	AFDB:B4XEZ3	0.291	0.280	1.906E-39	454	0.420	0.396	B4XEZ3.pdb.gz	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
4	AFDB:Q76LD0	0.200	0.194	1.158E-38	447	0.375	0.360	Q76LD0.pdb.gz	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
5	AFDB:Q9BU40	0.249	0.237	2.342E-37	456	0.394	0.371	Q9BU40.pdb.gz	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
6	AFDB:P98095	0.127	0.058	4.051E-3	1184	0.172	0.062	P98095.pdb.gz	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
7	AFDB:F1NWN4	0.116	0.054	5.325E-3	1196	0.126	0.045	F1NWN4.pdb.gz
8	AFDB:F1QJC9	0.145	0.048	5.589E-2	1447	0.161	0.048	F1QJC9.pdb.gz
9	AFDB:Q9ULE0	0.084	0.042	1.201E-1	1092	0.086	0.034	Q9ULE0.pdb.gz	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
10	PDB:3hksA	0.084	0.158	1.838E-1	144	0.033	0.097	3hksA.pdb.gz
11	PDB:2wzpA	0.075	0.112	3.175E-1	266	0.026	0.041	2wzpA.pdb.gz
12	PDB:6x0lP	0.082	0.076	3.175E-1	474	0.030	0.027	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
13	PDB:7rroT	0.071	0.067	3.542E-1	452	0.030	0.029	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	AFDB:P08553	0.054	0.033	3.586E-1	848	0.089	0.045	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
15	PDB:2zv6B	0.065	0.075	4.917E-1	371	0.012	0.013	2zv6B.pdb.gz
16	PDB:3w15A	0.105	0.132	4.917E-1	336	0.016	0.021	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
17	PDB:5a5yA	0.089	0.150	5.486E-1	211	0.035	0.071	5a5yA.pdb.gz	Structural Determinants for Substrate Binding and Catalysis in Triphosphate Tunnel Metalloenzymes.
18	PDB:3kq0A	0.083	0.173	6.119E-1	175	0.009	0.023	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
19	PDB:7ungU	0.098	0.089	6.827E-1	485	0.035	0.031	7ungU.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:7wb4h	0.069	0.092	6.827E-1	307	0.047	0.065	7wb4h.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6WN34	0.0	875	429	1.000	1.000	CRDL2_HUMAN Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1
2	Q8VEA6	0.0	653	426	0.725	0.730	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
3	B4XEZ3	9.92e-122	363	454	0.415	0.392	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
4	Q9BU40	1.27e-99	306	456	0.373	0.351	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
5	Q920C1	2.67e-99	305	447	0.385	0.369	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1
6	Q76LD0	1.53e-97	301	447	0.375	0.360	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
7	Q91713	9.29e-17	85.1	941	0.179	0.082	CHRD_XENLA Chordin OS=Xenopus laevis OX=8355 GN=chrd PE=1 SV=1
8	O57472	3.20e-14	77.4	940	0.177	0.081	CHRD_DANRE Chordin OS=Danio rerio OX=7955 GN=chd PE=2 SV=1
9	Q7T3Q2	1.37e-12	72.0	1027	0.179	0.075	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
10	Q3U492	2.92e-12	71.2	1550	0.186	0.052	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
11	Q24025	6.96e-12	70.1	1038	0.184	0.076	SOG_DROME Dorsal-ventral patterning protein Sog OS=Drosophila melanogaster OX=7227 GN=sog PE=1 SV=1
12	Q9H2X0	2.29e-10	65.1	955	0.186	0.084	CHRD_HUMAN Chordin OS=Homo sapiens OX=9606 GN=CHRD PE=1 SV=2
13	Q96DN2	4.35e-10	64.3	955	0.175	0.079	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
14	Q9NZV1	9.56e-09	60.1	1036	0.184	0.076	CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens OX=9606 GN=CRIM1 PE=1 SV=1
15	Q9Z0E2	2.90e-08	58.5	948	0.110	0.050	CHRD_MOUSE Chordin OS=Mus musculus OX=10090 GN=Chrd PE=1 SV=1
16	A0A0R4IQJ3	9.09e-08	57.0	4003	0.105	0.011	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
17	Q9GYX3	6.30e-07	54.3	751	0.091	0.052	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
18	Q9W2H2	7.37e-07	53.9	751	0.100	0.057	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
19	Q80T14	8.61e-07	53.9	4010	0.084	0.009	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
20	Q1HNM7	1.27e-06	48.1	83	0.063	0.325	Q1HNM7_PIG Collagen alpha-1(I) (Fragment) OS=Sus scrofa OX=9823 GN=COL1A1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19548 CHRDL_1_2_C	1.1e-06	40.3	Chordin-like protein 1/2 C-terminal
2	PF17043 MAT1-1-2	2.4e+02	12.8	Mating type protein 1-1-2 of unknown function
3	PF00093 VWC	2.3e-27	106.4	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000010524

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000006524	0.791	Serine/threonine-protein kinase receptor
2	9555.ENSPANP00000016924	0.710	Bone morphogenetic protein 4, isoform 3 (Predicted)
3	9555.ENSPANP00000005583	0.688	Repulsive guidance molecule family member b
4	9555.ENSPANP00000008261	0.671	Uncharacterized protein
5	9555.ENSPANP00000006390	0.666	Sclerostin domain containing 1
6	9555.ENSPANP00000020209	0.660	Bone morphogenetic protein receptor, type IA
7	9555.ENSPANP00000014480	0.656	Repulsive guidance molecule family member a
8	9555.ENSPANP00000005330	0.655	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
9	9555.ENSPANP00000007204	0.621	Twisted gastrulation BMP signaling modulator 1
10	9555.ENSPANP00000020050	0.604	Negatively regulates TGF-beta signaling.
11	9555.ENSPANP00000020759	0.600	Sclerostin
12	9555.ENSPANP00000000478	0.580	annotation not available
13	9555.ENSPANP00000005789	0.580	Hemochromatosis type 2 (juvenile)
14	9555.ENSPANP00000006615	0.538	Bone morphogenetic protein 5
15	9555.ENSPANP00000003135	0.536	Follistatin-like 1
16	9555.ENSPANP00000016533	0.509	FAM20A, golgi associated secretory pathway pseudokinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032501	0.988	multicellular organismal process
GO:0009966	0.982	regulation of signal transduction
GO:0007275	0.979	multicellular organism development
GO:0048523	0.978	negative regulation of cellular process
GO:0048731	0.934	system development
GO:0090092	0.930	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050896	0.902	response to stimulus
GO:0048585	0.857	negative regulation of response to stimulus
GO:0007165	0.848	signal transduction
GO:0007166	0.844	cell surface receptor signaling pathway
GO:0023057	0.841	negative regulation of signaling
GO:0019222	0.813	regulation of metabolic process
GO:0048518	0.810	positive regulation of biological process
GO:0048522	0.796	positive regulation of cellular process
GO:0090287	0.782	regulation of cellular response to growth factor stimulus
GO:0010648	0.766	negative regulation of cell communication
GO:0030510	0.759	regulation of BMP signaling pathway
GO:0009719	0.756	response to endogenous stimulus
GO:0007167	0.756	enzyme-linked receptor protein signaling pathway
GO:0070848	0.741	response to growth factor
GO:0030154	0.741	cell differentiation
GO:0009968	0.732	negative regulation of signal transduction
GO:0071495	0.718	cellular response to endogenous stimulus
GO:0090101	0.715	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090288	0.709	negative regulation of cellular response to growth factor stimulus
GO:0071363	0.707	cellular response to growth factor stimulus
GO:0060255	0.675	regulation of macromolecule metabolic process
GO:0007178	0.666	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0080090	0.656	regulation of primary metabolic process
GO:0051171	0.652	regulation of nitrogen compound metabolic process
GO:0031323	0.651	regulation of cellular metabolic process
GO:0071773	0.646	cellular response to BMP stimulus
GO:0048513	0.635	animal organ development
GO:0009888	0.569	tissue development
GO:0050793	0.495	regulation of developmental process
GO:0030509	0.494	BMP signaling pathway
GO:0030514	0.491	negative regulation of BMP signaling pathway
GO:0045595	0.472	regulation of cell differentiation
GO:0051239	0.360	regulation of multicellular organismal process
GO:0009893	0.357	positive regulation of metabolic process
GO:0051173	0.351	positive regulation of nitrogen compound metabolic process
GO:0010604	0.351	positive regulation of macromolecule metabolic process
GO:0070887	0.347	cellular response to chemical stimulus
GO:0009889	0.333	regulation of biosynthetic process
GO:0031325	0.331	positive regulation of cellular metabolic process
GO:0009967	0.316	positive regulation of signal transduction
GO:0042127	0.310	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.991	extracellular space
GO:0005737	0.720	cytoplasm
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0012505	0.594	endomembrane system
GO:0032991	0.426	protein-containing complex
GO:0016020	0.372	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]