StarFunc result for job id Q6WRI0

User Input

>input (2623 residues)
MKVKGRGITCLLVSFAVICLVATPGGKACPRRCACYMPTEVHCTFRYLTSIPDSIPPNVE
RINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKVRKL
QKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLNFLRLVHLEGNQLTKLHPDTFVSLSYLQ
IFKISFIKFLYLSDNFLTSLPQEMVSYMPDLDSLYLHGNPWTCDCHLKWLSDWIQEKPDV
IKCKKDRSPSSAQQCPLCMNPRTSKGKPLAMVSAAAFQCAKPTIDSSLKSKSLTILEDSS
SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFST
FLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQLYYKYKQVAPKPEDIFTNIEA
DLRADPSWLMQDQISLQLNRTATTFSTLQIQYSSDAQITLPRAEMRPVKHKWTMISRDNN
TKLEHTVLVGGTVGLNCPGQGDPTPHVDWLLADGSKVRAPYVSEDGRILIDKSGKLELQM
ADSFDTGVYHCISSNYDDADILTYRITVVEPLVEAYQENGIHHTVFIGETLDLPCHSTGI
PDASISWVIPGNNVLYQSSRDKKVLNNGTLRILQVTPKDQGYYRCVAANPSGVDFLIFQV
SVKMKGQRPLEHDGETEGSGLDESNPIAHLKEPPGAQLRTSALMEAEVGKHTSSTSKRHN
YRELTLQRRGDSTHRRFRENRRHFPPSARRIDPQHWAALLEKAKKNAMPDKRENTTVSPP
PVVTQLPNIPGEEDDSSGMLALHEEFMVPATKALNLPARTVTADSRTISDSPMTNINYGT
EFSPVVNSQILPPEEPTDFKLSTAIKTTAMSKNINPTMSSQIQGTTNQHSSTVFPLLLGA
TEFQDSDQMGRGREHFQSRPPITVRTMIKDVNVKMLSSTTNKLLLESVNTTNSHQTSVRE
VSEPRHNHFYSHTTQILSTSTFPSDPHTAAHSQFPIPRNSTVNIPLFRRFGRQRKIGGRG
RIISPYRTPVLRRHRYSIFRSTTRGSSEKSTTAFSATVLNVTCLSCLPRERLTTATAALS
FPSAAPITFPKADIARVPSEESTTLVQNPLLLLENKPSVEKTTPTIKYFRTEISQVTPTG
AVMTYAPTSIPMEKTHKVNASYPRVSSTNEAKRDSVITSSLSGAITKPPMTIIAITRFSR
RKIPWQQNFVNNHNPKGRLRNQHKVSLQKSTAVMLPKTSPALPRDKVSPFHFTTLSTSVM
QIPSNTLTTAHHTTTKTHNPGSLPTKKELPFPPLNPMLPSIISKDSSTKSIISTQTAIPA
TTPTFPASVITYETQTERSRAQTIQREQEPQKKNRTDPNISPDQSSGFTTPTAMTPPVLT
TAETSVKPSVSAFTHSPPENTTGISSTISFHSRTLNLTDVIEELAQASTQTLKSTIASET
TLSSKSHQSTTTRKAIIRHSTIPPFLSSSATLMPVPISPPFTQRAVTDNVATPISGLMTN
TVVKLHESSRHNAKPQQLVAEVATSPKVHPNAKFTIGTTHFIYSNLLHSTPMPALTTVKS
QNSKLTPSPWAENQFWHKPYSEIAEKGKKPEVSMLATTGLSEATTLVSDWDGQKNTKKSD
FDKKPVQEATTSKLLPFDSLSRYIFEKPRIVGGKAASFTIPANSDAFLPCEAVGNPLPTI
HWTRVPSGLDLSKRKQNSRVQVLPNGTLSIQRVEIQDRGQYLCSASNLFGTDHLHVTLSV
VSYPPRILERRTKEITVHSGSTVELKCRAEGRPSPTVTWILANQTVVSESSQGSRQAVVT
VDGTLVLHNLSIYDRGFYKCVASNPGGQDSLLVKIQVIAAPPVILEQRRQVIVGTWGESL
KLPCTAKGTPQPSVYWVLSDGTEVKPLQFTNSKLFLFSNGTLYIRNLASSDRGTYECIAT
SSTGSERRVVMLTMEERVTSPRIEAASQKRTEVNFGDKLLLNCSATGEPKPQIMWRLPSK
AVVDQQHRVGSWIHVYPNGSLFIGSVTEKDSGVYLCVARNKMGDDLILMHVSLRLKPAKI
DHKQYFRKQVLHGKDFQVDCKASGSPVPEISWSLPDGTMINNAMQADDSGHRTRRYTLFN
NGTLYFNKVGVAEEGDYTCYAQNTLGKDEMKVHLTVITAAPRIRQSNKTNKRIKAGDTAV
LDCEVTGDPKPKIFWLLPSNDMISFSIDRYTFHANGSLTINKVKLLDSGEYVCVARNPSG
DDTKMYKLDVVSKPPLINGLYTNRTVIKATAVRHSKKHFDCRAEGTPSPEVMWIMPDNIF
LTAPYYGSRITVHKNGTLEIRNVRLSDSADFICVARNEGGESVLVVQLEVLEMLRRPTFR
NPFNEKIVAQLGKSTALNCSVDGNPPPEIIWILPNGTRFSNGPQSYQYLIASNGSFIISK
TTREDAGKYRCAARNKVGYIEKLVILEIGQKPVILTYAPGTVKGISGESLSLHCVSDGIP
KPNIKWTMPSGYVVDRPQINGKYILHDNGTLVIKEATAYDRGNYICKAQNSVGHTLITVP
VMIVAYPPRITNRPPRSIVTRTGAAFQLHCVALGVPKPEITWEMPDHSLLSTASKERTHG
SEQLHLQGTLVIQNPQTSDSGIYKCTAKNPLGSDYAATYIQVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F5U2	0.244	0.256	0.000	2497	0.378	0.397	E7F5U2.pdb.gz
2	AFDB:Q3V1M1	0.261	0.264	0.000	2594	0.649	0.656	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
3	AFDB:Q6WRH9	0.270	0.272	0.000	2597	0.644	0.650	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
4	AFDB:Q6WRI0	1.000	1.000	0.000	2623	1.000	1.000	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
5	AFDB:Q9W213	0.094	0.147	9.914E-35	1395	0.066	0.124	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
6	AFDB:Q96MS0	0.097	0.158	1.111E-32	1386	0.065	0.123	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
7	PDB:5oj2B	0.067	0.160	3.456E-32	692	0.054	0.204	5oj2B.pdb.gz
8	AFDB:A0A2R8QRK0	0.089	0.137	6.911E-29	1420	0.066	0.122	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
9	AFDB:O55005	0.094	0.132	2.208E-27	1651	0.066	0.105	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
10	AFDB:A0A0G2JZA1	0.086	0.121	6.662E-27	1512	0.067	0.116	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
11	AFDB:Q967D7	0.068	0.101	5.487E-26	1531	0.056	0.097	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
12	PDB:1e07A	0.071	0.202	5.946E-26	642	0.048	0.195	1e07A.pdb.gz
13	PDB:5a42A	0.053	0.076	3.589E-19	1597	0.040	0.066	5a42A.pdb.gz
14	PDB:7sqcO0	0.072	0.123	2.435E-17	1140	0.033	0.076	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:6dldD	0.063	0.354	7.348E-17	269	0.026	0.249	6dldD.pdb.gz
16	PDB:6h03A	0.047	0.070	1.162E-15	1223	0.033	0.070	6h03A.pdb.gz
17	PDB:7q1yA	0.048	0.072	2.595E-15	1374	0.032	0.060	7q1yA.pdb.gz
18	PDB:7nycA	0.064	0.085	3.688E-15	1542	0.030	0.052	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7q5zA	0.065	0.097	6.407E-15	1344	0.030	0.058	7q5zA.pdb.gz
20	PDB:6dlfA	0.063	0.439	1.294E-14	236	0.023	0.254	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V1M1	0.0	3397	2594	0.651	0.658	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
2	Q6WRH9	0.0	3355	2597	0.646	0.653	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
3	Q6WRI0	0.0	5440	2623	1.000	1.000	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
4	Q9NR99	0.0	963	2828	0.172	0.159	MXRA5_HUMAN Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3
5	D3YXG0	4.90e-89	329	5634	0.112	0.052	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
6	E7F3V2	5.75e-87	322	4212	0.109	0.068	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
7	Q96RW7	6.45e-87	322	5635	0.100	0.046	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
8	A2AJ76	1.28e-85	317	5100	0.107	0.055	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
9	Q8NDA2	1.05e-81	305	5059	0.107	0.055	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
10	G5EDG4	1.14e-71	271	3962	0.097	0.064	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
11	G5EG33	1.33e-70	268	5198	0.096	0.049	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
12	G5ED27	1.74e-70	268	5175	0.096	0.049	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
13	Q0E9J8	3.57e-58	226	2031	0.095	0.123	Q0E9J8_DROME Down syndrome cell adhesion molecule 1, isoform AF OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
14	Q8WZ42	2.63e-57	224	34350	0.099	0.008	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	Q0E9J2	2.80e-57	223	2031	0.098	0.126	Q0E9J2_DROME Down syndrome cell adhesion molecule 1, isoform BG OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	A2ASS6	1.43e-55	219	35213	0.096	0.007	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
17	Q0E9J3	3.77e-55	216	2016	0.095	0.124	Q0E9J3_DROME Down syndrome cell adhesion molecule 1, isoform AA OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
18	A0A8I5ZUN3	4.31e-55	217	35375	0.085	0.006	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q0E9J1	1.38e-54	214	2017	0.096	0.125	Q0E9J1_DROME Down syndrome cell adhesion molecule 1, isoform Z OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
20	Q7TN00	1.95e-54	214	3410	0.085	0.065	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	18	16.9	Immunoglobulin C2-set domain
2	PF08205 C2-set_2	5.2e-19	79.4	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	8.3e-166	549.9	Immunoglobulin I-set domain
4	PF00047 ig	1.8e-106	359.9	Immunoglobulin domain
5	PF13895 Ig_2	5e-88	300.8	Immunoglobulin domain
6	PF13927 Ig_3	4.5e-161	535.1	Immunoglobulin domain
7	PF17736 Ig_C17orf99	4.3e-08	44.4	C17orf99 Ig domain
8	PF16706 Izumo-Ig	0.0013	30.0	Izumo-like Immunoglobulin domain
9	PF01462 LRRNT	15	16.6	Leucine rich repeat N-terminal domain
10	PF00560 LRR_1	70	15.3	Leucine Rich Repeat
11	PF12799 LRR_4	3.6e-08	44.8	Leucine Rich repeats (2 copies)
12	PF13306 LRR_5	0.0015	29.9	BspA type Leucine rich repeat region (6 copies)
13	PF13855 LRR_8	5.8e-26	101.3	Leucine rich repeat
14	PF14580 LRR_9	3.2e+02	12.3	Leucine-rich repeat
15	PF10572 UPF0556	12	17.3	UPF0556 domain
16	PF07686 V-set	9e-42	153.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282466

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376135	0.503	Zinc finger protein 605

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.979	regulation of biological process
GO:0009987	0.963	cellular process
GO:0050794	0.958	regulation of cellular process
GO:0032501	0.820	multicellular organismal process
GO:0032502	0.598	developmental process
GO:0048856	0.594	anatomical structure development
GO:0050896	0.484	response to stimulus
GO:0048731	0.472	system development
GO:0040012	0.339	regulation of locomotion
GO:0016043	0.325	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.963	extracellular region
GO:0071944	0.853	cell periphery
GO:0043226	0.727	organelle
GO:0043227	0.701	membrane-bounded organelle
GO:0016020	0.485	membrane
GO:0043231	0.348	intracellular membrane-bounded organelle
GO:0005634	0.338	nucleus
GO:0005886	0.318	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]