StarFunc result for job id Q6WRX3

User Input

>input (759 residues)
MVHFLHPGHTPRNIVPPDAQKDALGCCVVQEEASPYTLVNICLNVLIANLEKLCSERPDG
TLCLPEHWSFPQEVAERFLRVMTWQGKLTDRTASIFRGNQMKLKLVNIQKAKISTAAFIK
AFCRHKLIELNATAVHADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQL
TGLRILSVFNVCFHTEDLANVSQLPRLESLDISNTLVTDISALLTCKDRLKSLTMHYLKC
LAMTKSQILAVIRELKCLLHLDISDHRQLKSDLAFHLLQQKDILPNVVSLDISGGNCITD
EAVELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEALSRYRNRSCFV
KEALHRLFTETFSMEVTMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGLAKGMPV
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHEN
PKMQTMAVSVTSILALQLSPEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKAL
WNLTDGSPAACKHFIENQGLQIFIQVLETFSESAIQSKVLGLLNNIAEVRELSSKLVTED
VLKHINSLLCSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSC
KMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYHVCSKNPSKYCKMLVEEEGLQLLCD
IQEHSEATPKAQQIAASILDDFRMHFMNYQRPTLCQMPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0D3	0.916	0.934	1.934E-66	744	0.598	0.610	Q9C0D3.pdb.gz	ZY11B_HUMAN Protein zyg-11 homolog B OS=Homo sapiens OX=9606 GN=ZYG11B PE=1 SV=2
2	AFDB:P21541	0.742	0.710	5.938E-31	799	0.250	0.238	P21541.pdb.gz	ZYG11_CAEEL Early embryogenesis protein zyg-11 OS=Caenorhabditis elegans OX=6239 GN=zyg-11 PE=1 SV=1
3	AFDB:Q7Z7L7	0.681	0.675	6.810E-30	766	0.257	0.255	Q7Z7L7.pdb.gz	ZER1_HUMAN Protein zer-1 homolog OS=Homo sapiens OX=9606 GN=ZER1 PE=1 SV=1
4	AFDB:Q2WF59	0.608	0.530	1.641E-24	895	0.241	0.204	Q2WF59.pdb.gz	ZER1_CAEEL Zyg eleven-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=zer-1 PE=1 SV=1
5	AFDB:Q9M224	0.339	0.290	3.359E-12	928	0.140	0.114	Q9M224.pdb.gz	ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana OX=3702 GN=At3g60350 PE=2 SV=1
6	AFDB:O22161	0.356	0.298	4.760E-12	930	0.157	0.128	O22161.pdb.gz	ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana OX=3702 GN=FBX5 PE=1 SV=1
7	AFDB:O76522	0.309	0.425	2.169E-7	514	0.094	0.138	O76522.pdb.gz	O76522_DROME Karyopherin alpha 3 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Kap-alpha3 PE=2 SV=1
8	AFDB:Q9U308	0.306	0.198	8.746E-7	1254	0.097	0.059	Q9U308.pdb.gz	JAC1_CAEEL Juxtamembrane domain-associated catenin OS=Caenorhabditis elegans OX=6239 GN=jac-1 PE=1 SV=2
9	AFDB:Q6DGE9	0.235	0.197	1.447E-6	934	0.152	0.123	Q6DGE9.pdb.gz	UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio OX=7955 GN=unc45b PE=1 SV=2
10	AFDB:G5EB89	0.315	0.415	1.504E-6	553	0.079	0.108	G5EB89.pdb.gz	KAPA_EMENI Importin subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kapA PE=1 SV=1
11	PDB:4tnmA	0.307	0.525	3.436E-6	407	0.090	0.167	4tnmA.pdb.gz
12	PDB:1wa5B	0.330	0.506	1.186E-5	466	0.071	0.116	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:5tbkA	0.288	0.479	1.282E-5	417	0.087	0.158	5tbkA.pdb.gz
14	PDB:3tpoA	0.299	0.475	3.124E-5	438	0.074	0.128	3tpoA.pdb.gz
15	PDB:7rroH7	0.280	0.349	3.376E-5	580	0.066	0.086	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:5voxP	0.214	0.320	4.972E-5	462	0.079	0.130	5voxP.pdb.gz
17	PDB:6kbnC	0.303	0.423	7.613E-5	504	0.091	0.137	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
18	PDB:2z6gA	0.341	0.450	9.604E-5	550	0.123	0.169	2z6gA.pdb.gz
19	PDB:3w3zA	0.217	0.175	9.604E-5	1013	0.092	0.069	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
20	PDB:7anwA	0.308	0.357	1.038E-4	645	0.067	0.079	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0D3	0.0	903	744	0.599	0.612	ZY11B_HUMAN Protein zyg-11 homolog B OS=Homo sapiens OX=9606 GN=ZYG11B PE=1 SV=2
2	Q7Z7L7	5.52e-50	189	766	0.250	0.248	ZER1_HUMAN Protein zer-1 homolog OS=Homo sapiens OX=9606 GN=ZER1 PE=1 SV=1
3	P21541	8.77e-46	177	799	0.236	0.224	ZYG11_CAEEL Early embryogenesis protein zyg-11 OS=Caenorhabditis elegans OX=6239 GN=zyg-11 PE=1 SV=1
4	Q2WF59	9.64e-37	150	895	0.154	0.131	ZER1_CAEEL Zyg eleven-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=zer-1 PE=1 SV=1
5	O69634	0.18	37.7	541	0.030	0.043	O69634_MYCTO Peptide ABC transporter, peptide-binding protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3767 PE=4 SV=1
6	Q8NEE6	0.51	36.2	735	0.066	0.068	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
7	P0DJM0	0.67	35.8	800	0.062	0.059	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
8	Q8K4L4	1.3	34.7	587	0.046	0.060	POF1B_MOUSE Protein POF1B OS=Mus musculus OX=10090 GN=Pof1b PE=2 SV=3
9	P46133	2.0	34.3	508	0.037	0.055	ABGT_ECOLI p-aminobenzoyl-glutamate transport protein OS=Escherichia coli (strain K12) OX=83333 GN=abgT PE=1 SV=3
10	Q9VX09	2.4	33.9	607	0.042	0.053	ARP8_DROME Actin-related protein 8 OS=Drosophila melanogaster OX=7227 GN=Arp8 PE=1 SV=1
11	Q57TW4	2.9	33.9	1079	0.028	0.019	Q57TW4_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.240 PE=4 SV=1
12	P24814	3.8	33.5	1151	0.033	0.022	GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRR1 PE=1 SV=1
13	P42681	4.1	33.1	527	0.036	0.051	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
14	F8W3B7	4.4	33.1	640	0.032	0.037	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
15	Q9R016	4.6	33.1	1403	0.042	0.023	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3
16	Q57WJ3	5.4	32.7	687	0.024	0.026	Q57WJ3_TRYB2 Poly(A) polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.30 PE=3 SV=1
17	Q582V6	5.5	33.1	920	0.041	0.034	Q582V6_TRYB2 VPS9 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.490 PE=4 SV=1
18	Q9HUI8	5.9	32.7	559	0.020	0.027	ARUI_PSEAE Probable 2-ketoarginine decarboxylase AruI OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aruI PE=1 SV=1
19	P06779	6.1	32.7	565	0.036	0.048	RAD7_YEAST DNA repair protein RAD7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD7 PE=1 SV=3
20	Q57038	6.1	32.0	222	0.041	0.140	CYB6_SYNY3 Cytochrome b6 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=petB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	0.48	22.2	Leucine Rich repeats (2 copies)
2	PF13516 LRR_6	7.3e+02	11.7	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444856	0.895	Cullin-2
2	9606.ENSP00000478121	0.877	Elongin-C
3	9606.ENSP00000371253	0.759	Trifunctional purine biosynthetic protein adenosine-3
4	9606.ENSP00000480445	0.753	Myb/SANT-like DNA-binding domain-containing protein 3
5	9606.ENSP00000216225	0.718	E3 ubiquitin-protein ligase RBX1
6	9606.ENSP00000262306	0.698	Elongin-B
7	9606.ENSP00000298288	0.660	Leucine-rich repeat protein 1
8	9606.ENSP00000291900	0.657	Protein zer-1 homolog
9	9606.ENSP00000381693	0.633	Zinc finger SWIM-type containing 8
10	9606.ENSP00000300504	0.615	TBC1 domain family member 21
11	9606.ENSP00000279242	0.606	Mitochondrial ribosomal protein L49
12	9606.ENSP00000252744	0.593	Zinc finger SWIM-type containing 6
13	9606.ENSP00000352614	0.593	Zinc finger SWIM-type containing 5
14	9606.ENSP00000254323	0.550	Zinc finger SWIM-type containing 4
15	9606.ENSP00000294353	0.549	Protein zyg-11 homolog B
16	9606.ENSP00000308236	0.540	COMM domain-containing protein 1
17	9606.ENSP00000321388	0.540	Ankyrin repeat and SOCS box protein 4
18	9606.ENSP00000359385	0.540	Glomulin
19	9606.ENSP00000337040	0.525	Protein unc-119 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.996	protein metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0048518	0.953	positive regulation of biological process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0009987	0.936	cellular process
GO:0009056	0.922	catabolic process
GO:0051603	0.910	proteolysis involved in protein catabolic process
GO:0051173	0.894	positive regulation of nitrogen compound metabolic process
GO:0051246	0.893	regulation of protein metabolic process
GO:0010604	0.890	positive regulation of macromolecule metabolic process
GO:0048522	0.887	positive regulation of cellular process
GO:0051247	0.850	positive regulation of protein metabolic process
GO:0009894	0.837	regulation of catabolic process
GO:0031329	0.800	regulation of cellular catabolic process
GO:0031325	0.777	positive regulation of cellular metabolic process
GO:0030162	0.771	regulation of proteolysis
GO:0009896	0.671	positive regulation of catabolic process
GO:2000058	0.645	regulation of ubiquitin-dependent protein catabolic process
GO:0031331	0.636	positive regulation of cellular catabolic process
GO:0042176	0.620	regulation of protein catabolic process
GO:0044237	0.607	cellular metabolic process
GO:0032434	0.584	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0045862	0.513	positive regulation of proteolysis
GO:1903052	0.485	positive regulation of proteolysis involved in protein catabolic process
GO:2000060	0.484	positive regulation of ubiquitin-dependent protein catabolic process
GO:0045732	0.483	positive regulation of protein catabolic process
GO:0032501	0.455	multicellular organismal process
GO:1901800	0.409	positive regulation of proteasomal protein catabolic process
GO:0032436	0.400	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0022414	0.388	reproductive process
GO:0006515	0.374	protein quality control for misfolded or incompletely synthesized proteins

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000151	0.995	ubiquitin ligase complex
GO:0031462	0.985	Cul2-RING ubiquitin ligase complex
GO:0005829	0.948	cytosol
GO:0043226	0.765	organelle
GO:0043229	0.694	intracellular organelle
GO:0070013	0.470	intracellular organelle lumen
GO:0031981	0.424	nuclear lumen
GO:0005654	0.311	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]