StarFunc result for job id Q6X4U4

User Input

>input (206 residues)
MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHF
SNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGT
KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFE
SMSPAKPVQHHRERKRASKSSKHSMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6X4U4	1.000	1.000	1.206E-33	206	1.000	1.000	Q6X4U4.pdb.gz	SOSD1_HUMAN Sclerostin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SOSTDC1 PE=1 SV=2
2	AFDB:Q9BQB4	0.455	0.441	1.647E-15	213	0.379	0.366	Q9BQB4.pdb.gz	SOST_HUMAN Sclerostin OS=Homo sapiens OX=9606 GN=SOST PE=1 SV=1
3	AFDB:Q99P67	0.462	0.448	5.354E-15	213	0.383	0.371	Q99P67.pdb.gz	SOST_RAT Sclerostin OS=Rattus norvegicus OX=10116 GN=Sost PE=2 SV=1
4	PDB:2k8pA	0.378	0.406	1.474E-11	189	0.350	0.381	2k8pA.pdb.gz
5	AFDB:A0A0G2K8X5	0.358	0.081	1.036E-4	1032	0.131	0.026	A0A0G2K8X5.pdb.gz	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
6	PDB:5hk5F	0.303	0.465	1.458E-3	129	0.131	0.209	5hk5F.pdb.gz
7	PDB:1hcnB	0.310	0.518	9.830E-3	110	0.102	0.191	1hcnB.pdb.gz
8	AFDB:Q8MS79	0.326	0.114	1.446E-2	661	0.107	0.033	Q8MS79.pdb.gz	Q8MS79_DROME LP05709p OS=Drosophila melanogaster OX=7227 GN=Hml PE=2 SV=1
9	PDB:4mqwB	0.307	0.524	1.928E-2	109	0.092	0.174	4mqwB.pdb.gz
10	AFDB:G8BHR4	0.123	0.059	3.356E-2	584	0.121	0.043	G8BHR4.pdb.gz	G8BHR4_CANPC chitinase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CHT2 PE=3 SV=1
11	PDB:4my2A	0.310	0.140	4.230E-2	474	0.083	0.036	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
12	PDB:1wq8A	0.224	0.379	4.474E-2	100	0.107	0.220	1wq8A.pdb.gz
13	AFDB:G8BHR3	0.111	0.041	4.700E-2	913	0.126	0.028	G8BHR3.pdb.gz	G8BHR3_CANPC GH18 domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CHT21 PE=4 SV=1
14	PDB:7t9iB	0.282	0.480	5.005E-2	109	0.102	0.193	7t9iB.pdb.gz
15	PDB:6hgoC	0.243	0.363	5.600E-2	127	0.092	0.150	6hgoC.pdb.gz
16	AFDB:Q98TU0	0.246	0.220	5.884E-2	235	0.131	0.115	Q98TU0.pdb.gz	GDNF_DANRE Glial cell line-derived neurotrophic factor OS=Danio rerio OX=7955 GN=gdnf PE=1 SV=1
17	PDB:1m4uA	0.283	0.292	6.265E-2	199	0.068	0.070	1m4uA.pdb.gz
18	PDB:7uwmA	0.267	0.449	7.842E-2	109	0.092	0.174	7uwmA.pdb.gz
19	AFDB:Q6FUW3	0.159	0.050	8.715E-2	975	0.131	0.028	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
20	AFDB:Q9W2N4	0.124	0.068	1.365E-1	505	0.092	0.038	Q9W2N4.pdb.gz	Q9W2N4_DROME RIC3 acetylcholine receptor chaperone, isoform C OS=Drosophila melanogaster OX=7227 GN=RIC-3 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6X4U4	2.21e-156	432	206	1.000	1.000	SOSD1_HUMAN Sclerostin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SOSTDC1 PE=1 SV=2
2	Q9CQN4	8.92e-149	413	206	0.947	0.947	SOSD1_MOUSE Sclerostin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sostdc1 PE=1 SV=1
3	Q99P67	5.25e-36	127	213	0.383	0.371	SOST_RAT Sclerostin OS=Rattus norvegicus OX=10116 GN=Sost PE=2 SV=1
4	Q99P68	6.52e-35	124	211	0.364	0.355	SOST_MOUSE Sclerostin OS=Mus musculus OX=10090 GN=Sost PE=1 SV=2
5	Q9BQB4	2.55e-34	123	213	0.364	0.352	SOST_HUMAN Sclerostin OS=Homo sapiens OX=9606 GN=SOST PE=1 SV=1
6	F1QL10	0.015	38.1	369	0.112	0.062	F1QL10_DANRE Cellular communication network factor 1 OS=Danio rerio OX=7955 GN=cyr61 PE=3 SV=1
7	O00622	0.13	35.0	381	0.107	0.058	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
8	P18406	0.22	34.3	379	0.107	0.058	CCN1_MOUSE CCN family member 1 OS=Mus musculus OX=10090 GN=Ccn1 PE=1 SV=1
9	Q9ES72	0.24	34.3	379	0.107	0.058	CCN1_RAT CCN family member 1 OS=Rattus norvegicus OX=10116 GN=Ccn1 PE=2 SV=1
10	P0ABZ6	1.5	32.0	428	0.087	0.042	SURA_ECOLI Chaperone SurA OS=Escherichia coli (strain K12) OX=83333 GN=surA PE=1 SV=1
11	P0ABZ8	1.5	32.0	428	0.087	0.042	SURA_ECO57 Chaperone SurA OS=Escherichia coli O157:H7 OX=83334 GN=surA PE=1 SV=1
12	A0A0G2K1Y4	1.7	32.0	3586	0.155	0.009	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
13	A0A0G2K8X5	1.7	32.0	3922	0.155	0.008	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
14	O95388	1.8	31.6	367	0.068	0.038	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
15	O35888	2.7	31.2	1034	0.155	0.031	O35888_RAT Mucin OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
16	Q9HCR9	4.5	30.8	933	0.058	0.013	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
17	P98088	5.5	30.4	5654	0.136	0.005	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
18	Q9CVD4	5.8	28.9	98	0.058	0.122	Q9CVD4_MOUSE CTCK domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5ac PE=2 SV=1
19	Q9FLV0	6.4	30.0	341	0.078	0.047	DMR6_ARATH Protein DOWNY MILDEW RESISTANCE 6 OS=Arabidopsis thaliana OX=3702 GN=DMR6 PE=1 SV=1
20	Q99PP0	6.5	30.0	367	0.063	0.035	CCN4_RAT CCN family member 4 OS=Rattus norvegicus OX=10116 GN=Ccn4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	0.061	25.0	Cystine-knot domain
2	PF03045 DAN	7.5e-11	53.4	DAN domain
3	PF05463 Sclerostin	5.7e-104	357.6	Sclerostin (SOST)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379204	0.990	Bone morphogenetic protein 7
2	9606.ENSP00000368104	0.961	Bone morphogenetic protein 2
3	9606.ENSP00000245451	0.960	Bone morphogenetic protein 4
4	9606.ENSP00000401907	0.941	Bone morphogenetic protein receptor type-1B
5	9606.ENSP00000361107	0.935	Bone morphogenetic protein receptor type-1A
6	9606.ENSP00000337014	0.922	Hemojuvelin
7	9606.ENSP00000363708	0.916	Bone morphogenetic protein receptor type-2
8	9606.ENSP00000364683	0.914	BMP and activin membrane-bound inhibitor homolog
9	9606.ENSP00000452126	0.909	Repulsive guidance molecule A
10	9606.ENSP00000308219	0.908	RGM domain family member B
11	9606.ENSP00000263671	0.709	Chordin-related protein 2 variant III
12	9606.ENSP00000297161	0.694	BMP-binding endothelial regulator protein
13	9606.ENSP00000361112	0.691	Chordin-like protein 1
14	9606.ENSP00000305334	0.674	Follistatin-related protein 5
15	9606.ENSP00000304286	0.604	Forkhead box protein I1
16	9606.ENSP00000294304	0.590	Low-density lipoprotein receptor-related protein 5
17	9606.ENSP00000426653	0.584	Protein Wnt-8a
18	9606.ENSP00000318650	0.556	Gremlin-2
19	9606.ENSP00000479679	0.552	Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity)
20	9606.ENSP00000220812	0.542	Dickkopf-related protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019955	0.965	cytokine binding
GO:0036122	0.963	BMP binding
GO:0003824	0.962	catalytic activity
GO:0140096	0.931	catalytic activity, acting on a protein
GO:0004675	0.917	transmembrane receptor protein serine/threonine kinase activity
GO:0098821	0.670	BMP receptor activity
GO:0098772	0.508	molecular function regulator activity
GO:0005102	0.387	signaling receptor binding
GO:0140677	0.322	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048523	0.995	negative regulation of cellular process
GO:0030514	0.992	negative regulation of BMP signaling pathway
GO:0032501	0.990	multicellular organismal process
GO:0032502	0.982	developmental process
GO:0030178	0.981	negative regulation of Wnt signaling pathway
GO:0048856	0.963	anatomical structure development
GO:0009987	0.961	cellular process
GO:0045595	0.949	regulation of cell differentiation
GO:0045596	0.943	negative regulation of cell differentiation
GO:0050896	0.910	response to stimulus
GO:0051239	0.877	regulation of multicellular organismal process
GO:0051716	0.866	cellular response to stimulus
GO:0007275	0.801	multicellular organism development
GO:0051241	0.801	negative regulation of multicellular organismal process
GO:0060828	0.753	regulation of canonical Wnt signaling pathway
GO:0048513	0.751	animal organ development
GO:0009719	0.745	response to endogenous stimulus
GO:0023052	0.726	signaling
GO:0007154	0.726	cell communication
GO:0007165	0.716	signal transduction
GO:0048518	0.688	positive regulation of biological process
GO:0007166	0.686	cell surface receptor signaling pathway
GO:0042303	0.667	molting cycle
GO:0009888	0.664	tissue development
GO:0009653	0.658	anatomical structure morphogenesis
GO:0042633	0.639	hair cycle
GO:0019222	0.605	regulation of metabolic process
GO:0090090	0.591	negative regulation of canonical Wnt signaling pathway
GO:0060255	0.585	regulation of macromolecule metabolic process
GO:0071495	0.577	cellular response to endogenous stimulus
GO:0070848	0.553	response to growth factor
GO:0048522	0.551	positive regulation of cellular process
GO:0080090	0.479	regulation of primary metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0071363	0.477	cellular response to growth factor stimulus
GO:0022404	0.459	molting cycle process
GO:0048869	0.455	cellular developmental process
GO:0030154	0.454	cell differentiation
GO:0007267	0.443	cell-cell signaling
GO:0048731	0.437	system development
GO:0010468	0.379	regulation of gene expression
GO:0009889	0.372	regulation of biosynthetic process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0019219	0.346	regulation of nucleobase-containing compound metabolic process
GO:0007178	0.343	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051252	0.341	regulation of RNA metabolic process
GO:0031326	0.336	regulation of cellular biosynthetic process
GO:0010556	0.328	regulation of macromolecule biosynthetic process
GO:0045661	0.309	regulation of myoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.312	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.917	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.917	receptor protein serine/threonine kinase.

[back to server]