StarFunc result for job id Q6XE24

User Input

>input (437 residues)
MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSK
TNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVA
SLKANGVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSR
GVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMIL
HQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV
DTSNEHAPAYSYQQSKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6XE24	0.999	0.999	1.006E-72	437	1.000	1.000	Q6XE24.pdb.gz	RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens OX=9606 GN=RBMS3 PE=1 SV=1
2	AFDB:P29558	0.476	0.507	3.749E-53	406	0.719	0.773	P29558.pdb.gz	RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3
3	AFDB:Q8MSV2	0.385	0.295	1.963E-30	590	0.382	0.283	Q8MSV2.pdb.gz	SHEP_DROME Protein alan shepard OS=Drosophila melanogaster OX=7227 GN=shep PE=1 SV=2
4	AFDB:Q57WD0	0.196	0.148	1.532E-17	593	0.217	0.160	Q57WD0.pdb.gz	Q57WD0_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.400 PE=4 SV=1
5	AFDB:K7EQ02	0.189	0.243	9.215E-16	327	0.178	0.239	K7EQ02.pdb.gz	K7EQ02_HUMAN DAZ associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=2
6	AFDB:P48809	0.197	0.203	1.898E-14	421	0.160	0.166	P48809.pdb.gz	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
7	AFDB:Q96T37	0.176	0.087	4.289E-12	977	0.162	0.073	Q96T37.pdb.gz	RBM15_HUMAN RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
8	AFDB:Q9SJG8	0.176	0.097	7.564E-12	843	0.174	0.090	Q9SJG8.pdb.gz	AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana OX=3702 GN=ML2 PE=2 SV=2
9	AFDB:A0A0S2Z4Z0	0.182	0.136	8.580E-12	669	0.183	0.120	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
10	PDB:6y53o	0.166	0.434	8.871E-12	160	0.103	0.281	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	PDB:7oqcF	0.159	0.252	2.283E-11	267	0.092	0.150	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	AFDB:O43719	0.170	0.102	3.223E-11	755	0.156	0.090	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
13	PDB:5lsbA	0.178	0.395	1.067E-9	176	0.080	0.199	5lsbA.pdb.gz
14	PDB:6y5qq	0.163	0.371	1.211E-9	178	0.085	0.208	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5vsuA	0.171	0.191	3.319E-9	387	0.069	0.078	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:6r5kH	0.153	0.168	1.938E-8	394	0.101	0.112	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:7evoD	0.161	0.343	5.659E-8	200	0.085	0.185	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
18	PDB:6gd1A	0.159	0.361	1.408E-6	190	0.053	0.121	6gd1A.pdb.gz
19	PDB:6c0fo	0.179	0.556	2.484E-6	133	0.057	0.188	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
20	PDB:7dvqY	0.172	0.509	3.000E-6	140	0.037	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ETU5	0.0	540	370	0.627	0.741	E7ETU5_HUMAN RNA binding motif single stranded interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=1
2	F1QGV3	0.0	705	415	0.824	0.867	F1QGV3_DANRE RNA-binding motif, single stranded-interacting protein OS=Danio rerio OX=7955 GN=zgc:153698 PE=4 SV=1
3	P29558	0.0	565	406	0.719	0.773	RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3
4	Q08C34	0.0	667	381	0.746	0.856	Q08C34_DANRE RNA binding motif, single stranded interacting protein OS=Danio rerio OX=7955 GN=zgc:153698 PE=2 SV=1
5	Q6XE24	0.0	899	437	1.000	1.000	RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens OX=9606 GN=RBMS3 PE=1 SV=1
6	Q8BWL5	0.0	771	431	0.915	0.928	RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus OX=10090 GN=Rbms3 PE=2 SV=2
7	Q15434	2.22e-178	506	407	0.586	0.629	RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens OX=9606 GN=RBMS2 PE=1 SV=1
8	Q8MSV2	1.02e-75	249	590	0.304	0.225	SHEP_DROME Protein alan shepard OS=Drosophila melanogaster OX=7227 GN=shep PE=1 SV=2
9	D5MCQ1	1.24e-60	202	354	0.243	0.299	D5MCQ1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
10	Q7JMB8	1.71e-60	202	357	0.243	0.297	Q7JMB8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
11	D5MCQ2	5.72e-60	202	380	0.254	0.292	D5MCQ2_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
12	D5MCQ7	6.24e-60	202	412	0.243	0.257	D5MCQ7_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
13	D5MCR4	6.38e-60	203	424	0.243	0.250	D5MCR4_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
14	D5MCQ4	9.30e-60	199	316	0.238	0.329	D5MCQ4_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
15	D5MCQ3	1.03e-59	202	406	0.254	0.273	D5MCQ3_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
16	Q21900	1.19e-59	202	409	0.254	0.271	Q21900_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=2
17	D5MCQ6	1.93e-59	202	438	0.254	0.253	D5MCQ6_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
18	D5MCR3	2.12e-59	203	476	0.243	0.223	D5MCR3_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
19	D5MCR5	3.01e-59	199	371	0.238	0.280	D5MCR5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
20	D5MCQ8	3.51e-59	199	374	0.238	0.278	D5MCQ8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.4e-27	106.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF16367 RRM_7	37	15.8	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003936109.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010349470.1	0.700	Glioma tumor suppressor candidate region gene 1 protein
2	27679.XP_010337706.1	0.658	poly(A)-specific ribonuclease PARN
3	27679.XP_003928527.1	0.638	Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase
4	27679.XP_003932972.1	0.638	Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase
5	27679.XP_010332728.1	0.638	Transmembrane protein 136 isoform X2
6	27679.XP_003941405.1	0.631	Transmembrane protein 141
7	27679.XP_003934511.1	0.577	IQ motif and SEC7 domain-containing protein 3 isoform X2
8	27679.XP_010330461.1	0.572	Zinc finger MYM-type protein 5
9	27679.XP_003930692.1	0.570	Transmembrane protein 236
10	27679.XP_010343182.1	0.553	SAM domain-containing protein SAMSN-1 isoform X1
11	27679.XP_003941395.1	0.536	Chloride intracellular channel protein 3 isoform X1
12	27679.XP_003930186.1	0.532	C-type lectin domain family 19 member A
13	27679.XP_010344857.1	0.528	COX assembly mitochondrial protein homolog isoform X1
14	27679.XP_003927374.1	0.502	RNA-binding protein 24
15	27679.XP_010346676.1	0.502	LOW QUALITY PROTEIN: proteasome maturation protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.983	protein binding
GO:0003727	0.781	single-stranded RNA binding
GO:0008143	0.764	poly(A) binding
GO:0008266	0.750	poly(U) RNA binding
GO:0035925	0.675	mRNA 3'-UTR AU-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.884	regulation of macromolecule metabolic process
GO:0048583	0.874	regulation of response to stimulus
GO:0010468	0.856	regulation of gene expression
GO:0023051	0.787	regulation of signaling
GO:0010646	0.785	regulation of cell communication
GO:0009987	0.783	cellular process
GO:0009966	0.705	regulation of signal transduction
GO:0048518	0.681	positive regulation of biological process
GO:0050896	0.643	response to stimulus
GO:0048519	0.596	negative regulation of biological process
GO:0051171	0.517	regulation of nitrogen compound metabolic process
GO:0009893	0.480	positive regulation of metabolic process
GO:0010604	0.471	positive regulation of macromolecule metabolic process
GO:0048523	0.470	negative regulation of cellular process
GO:0080090	0.446	regulation of primary metabolic process
GO:0031323	0.395	regulation of cellular metabolic process
GO:0008152	0.381	metabolic process
GO:0010605	0.347	negative regulation of macromolecule metabolic process
GO:0071704	0.332	organic substance metabolic process
GO:0048522	0.302	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.678	cytosol
GO:0043227	0.414	membrane-bounded organelle
GO:0043231	0.366	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]