StarFunc result for job id Q6XQN6

User Input

>input (538 residues)
MAAEQDPEARAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGV
DLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDE
EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQ
GQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6XQN6	1.000	1.000	0.000	538	1.000	1.000	Q6XQN6.pdb.gz	PNCB_HUMAN Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2
2	AFDB:Q6XQN1	0.971	0.971	4.717E-95	538	0.803	0.803	Q6XQN1.pdb.gz	PNCB_RAT Nicotinate phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Naprt PE=2 SV=1
3	PDB:4yubB	0.889	0.953	3.509E-80	501	0.920	0.988	4yubB.pdb.gz
4	AFDB:C6KTC6	0.916	0.745	2.795E-55	665	0.305	0.247	C6KTC6.pdb.gz	C6KTC6_PLAF7 nicotinate phosphoribosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0629100 PE=3 SV=1
5	AFDB:P9WJI7	0.769	0.890	5.952E-40	463	0.297	0.346	P9WJI7.pdb.gz	PNCB2_MYCTU Nicotinate phosphoribosyltransferase pncB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pncB2 PE=1 SV=1
6	AFDB:P9WJI9	0.711	0.849	2.216E-38	448	0.284	0.342	P9WJI9.pdb.gz	PNCB1_MYCTU Nicotinate phosphoribosyltransferase pncB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pncB1 PE=1 SV=1
7	AFDB:A0A024R718	0.549	0.595	4.204E-15	491	0.160	0.175	A0A024R718.pdb.gz
8	AFDB:E7F8T6	0.542	0.586	6.517E-15	493	0.165	0.181	E7F8T6.pdb.gz	E7F8T6_DANRE Nicotinamide phosphoribosyltransferase OS=Danio rerio OX=7955 GN=nampta PE=1 SV=1
9	AFDB:A0A1D8PRI0	0.286	0.357	1.748E-14	421	0.145	0.185	A0A1D8PRI0.pdb.gz	A0A1D8PRI0_CANAL Nicotinate phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NPT1 PE=3 SV=1
10	AFDB:Q389I2	0.284	0.350	2.060E-14	428	0.177	0.222	Q389I2.pdb.gz	Q389I2_TRYB2 nicotinate phosphoribosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0320 PE=3 SV=1
11	PDB:1vlpB	0.289	0.364	2.275E-14	419	0.143	0.184	1vlpB.pdb.gz
12	AFDB:P39683	0.299	0.368	2.862E-14	429	0.145	0.182	P39683.pdb.gz	NPT1_YEAST Nicotinate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPT1 PE=1 SV=3
13	PDB:4jnmB	0.553	0.619	3.161E-14	473	0.154	0.175	4jnmB.pdb.gz	Discovery of potent and efficacious urea-containing nicotinamide phosphoribosyltransferase (NAMPT) inhibitors with reduced CYP2C9 inhibition properties.
14	PDB:4kwvF	0.359	0.618	2.145E-9	291	0.119	0.220	4kwvF.pdb.gz
15	PDB:4i9aA	0.345	0.605	5.156E-9	288	0.119	0.222	4i9aA.pdb.gz	Crystal structure of Sus scrofa quinolinate phosphoribosyltransferase in complex with nicotinate mononucleotide
16	PDB:1qpnA	0.348	0.617	1.921E-8	284	0.110	0.208	1qpnA.pdb.gz	Crystal structure of quinolinic acid phosphoribosyltransferase from Mycobacterium tuberculosis: a potential TB drug target.
17	PDB:3c2vA	0.273	0.492	1.917E-5	270	0.086	0.170	3c2vA.pdb.gz	Comprehensive X-ray Structural Studies of the Quinolinate Phosphoribosyl Transferase (BNA6) from Saccharomyces cerevisiae.
18	PDB:4pb3B	0.234	0.305	2.521E-5	389	0.100	0.139	4pb3B.pdb.gz	Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
19	PDB:1f3tB	0.238	0.318	5.732E-4	381	0.097	0.136	1f3tB.pdb.gz	Altering the reaction specificity of eukaryotic ornithine decarboxylase.
20	PDB:6sczA	0.256	0.348	1.047E-3	373	0.113	0.164	6sczA.pdb.gz	D-Cycloserine destruction by alanine racemase and the limit of irreversible inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6XQN1	0.0	855	538	0.810	0.810	PNCB_RAT Nicotinate phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Naprt PE=2 SV=1
2	Q6XQN6	0.0	1061	538	1.000	1.000	PNCB_HUMAN Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2
3	C6KTC6	7.43e-107	335	665	0.309	0.250	C6KTC6_PLAF7 nicotinate phosphoribosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0629100 PE=3 SV=1
4	P9WJI7	2.88e-48	176	463	0.316	0.367	PNCB2_MYCTU Nicotinate phosphoribosyltransferase pncB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pncB2 PE=1 SV=1
5	P9WJI9	3.18e-31	128	448	0.266	0.319	PNCB1_MYCTU Nicotinate phosphoribosyltransferase pncB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pncB1 PE=1 SV=1
6	P18133	1.27e-04	47.0	400	0.212	0.285	PNCB_ECOLI Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pncB PE=1 SV=3
7	Q389I2	0.17	37.0	428	0.091	0.114	Q389I2_TRYB2 nicotinate phosphoribosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0320 PE=3 SV=1
8	Q9ZVQ4	0.68	34.3	223	0.033	0.081	GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana OX=3702 GN=GSTZ2 PE=3 SV=1
9	Q9ZVQ3	4.3	32.0	221	0.033	0.081	GSTZ1_ARATH Glutathione S-transferase Z1 OS=Arabidopsis thaliana OX=3702 GN=GSTZ1 PE=1 SV=1
10	P9WNL9	8.3	32.0	1094	0.054	0.027	EMBA_MYCTU Probable arabinosyltransferase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=embA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04095 NAPRTase	0.87	20.6	Nicotinate phosphoribosyltransferase (NAPRTase) family
2	PF17956 NAPRTase_C	2.4e-22	90.8	Nicotinate phosphoribosyltransferase C-terminal domain
3	PF17767 NAPRTase_N	5.8e-27	105.8	Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain
4	PF03671 Ufm1	3.9e+02	12.4	Ubiquitin fold modifier 1 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378782	0.988	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
2	9606.ENSP00000366410	0.981	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
3	9606.ENSP00000354387	0.979	Nicotinamide riboside kinase 1
4	9606.ENSP00000340523	0.978	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
5	9606.ENSP00000287713	0.976	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
6	9606.ENSP00000480091	0.965	Nicotinamide riboside kinase 2
7	9606.ENSP00000354532	0.959	Purine nucleoside phosphorylase
8	9606.ENSP00000230792	0.949	Peroxisomal NADH pyrophosphatase NUDT12
9	9606.ENSP00000235628	0.910	Cytosolic 5'-nucleotidase 1A
10	9606.ENSP00000354238	0.907	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
11	9606.ENSP00000406261	0.907	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
12	9606.ENSP00000245552	0.903	5'(3')-deoxyribonucleotidase, cytosolic type
13	9606.ENSP00000339479	0.902	Cytosolic purine 5'-nucleotidase
14	9606.ENSP00000373674	0.902	5'(3')-deoxyribonucleotidase, mitochondrial
15	9606.ENSP00000352904	0.900	Cytosolic 5'-nucleotidase 1B
16	9606.ENSP00000433415	0.900	NT5C1B-RDH14 readthrough
17	9606.ENSP00000326424	0.882	Glutamine-dependent NAD(+) synthetase
18	9606.ENSP00000222553	0.848	Nicotinamide phosphoribosyltransferase
19	9606.ENSP00000469591	0.753	Zinc finger protein 628
20	9606.ENSP00000294973	0.748	3-hydroxyanthranilate 3,4-dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004516	1.000	nicotinate phosphoribosyltransferase activity
GO:0016740	0.477	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.953	response to stimulus
GO:0071704	0.905	organic substance metabolic process
GO:0044237	0.904	cellular metabolic process
GO:0044238	0.903	primary metabolic process
GO:0006979	0.881	response to oxidative stress
GO:0046483	0.864	heterocycle metabolic process
GO:0006807	0.855	nitrogen compound metabolic process
GO:0044281	0.850	small molecule metabolic process
GO:1901360	0.823	organic cyclic compound metabolic process
GO:1901564	0.819	organonitrogen compound metabolic process
GO:0034641	0.817	cellular nitrogen compound metabolic process
GO:0006725	0.806	cellular aromatic compound metabolic process
GO:0006139	0.793	nucleobase-containing compound metabolic process
GO:0019637	0.639	organophosphate metabolic process
GO:0006796	0.626	phosphate-containing compound metabolic process
GO:0055086	0.622	nucleobase-containing small molecule metabolic process
GO:0009117	0.601	nucleotide metabolic process
GO:0006163	0.499	purine nucleotide metabolic process
GO:0044249	0.477	cellular biosynthetic process
GO:1901576	0.455	organic substance biosynthetic process
GO:0044271	0.418	cellular nitrogen compound biosynthetic process
GO:0072524	0.390	pyridine-containing compound metabolic process
GO:1901362	0.389	organic cyclic compound biosynthetic process
GO:0018130	0.385	heterocycle biosynthetic process
GO:0009165	0.371	nucleotide biosynthetic process
GO:0046496	0.331	nicotinamide nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0070062	0.997	extracellular exosome
GO:0012505	0.991	endomembrane system
GO:0031410	0.962	cytoplasmic vesicle
GO:0030141	0.950	secretory granule
GO:0034774	0.933	secretory granule lumen
GO:0005764	0.925	lysosome
GO:0035578	0.916	azurophil granule lumen
GO:0005634	0.642	nucleus
GO:0031981	0.357	nuclear lumen
GO:0005654	0.321	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36163	1.000	5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate
EC:6.3.4.21	1.000	nicotinate phosphoribosyltransferase.
EC:2.-.-.-	0.477	Transferases.

[back to server]