StarFunc result for job id Q6XUX3

User Input

>input (929 residues)
MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHN
HTCLSSLTGGGGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQD
CNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAH
QGNWETIPEEDLEVQENNEDAAHVLAELEVTMHHALLQEVDVVVAPCQGLRPTVDVLGDL
VNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFKVPKLGSEIIDSSTRRMESER
SPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQVLQTRLVDAAK
ALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKL
ISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRM
LWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAF
AASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGR
GQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDY
NYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKL
KNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLG
IVQPMLQGIMNRLCKSNSEQPNRGLDDST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6XUX3	1.000	1.000	0.000	929	1.000	1.000	Q6XUX3.pdb.gz	DUSTY_HUMAN Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens OX=9606 GN=DSTYK PE=1 SV=2
2	AFDB:Q4VSN1	0.900	0.944	7.904E-98	885	0.661	0.694	Q4VSN1.pdb.gz	DUSTY_DANRE Dual serine/threonine and tyrosine protein kinase OS=Danio rerio OX=7955 GN=dstyk PE=2 SV=1
3	AFDB:P55144	0.271	0.286	1.333E-15	880	0.075	0.080	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
4	AFDB:Q54JC7	0.259	0.182	1.333E-15	1347	0.098	0.068	Q54JC7.pdb.gz	Y1197_DICDI Probable serine/threonine-protein kinase DDB_G0288147 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288147 PE=3 SV=1
5	AFDB:Q06418	0.266	0.277	2.165E-15	890	0.075	0.079	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
6	AFDB:O22558	0.254	0.426	3.514E-15	546	0.078	0.132	O22558.pdb.gz	STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana OX=3702 GN=STY8 PE=1 SV=2
7	AFDB:A0A1D8PM87	0.264	0.169	4.192E-15	1483	0.096	0.060	A0A1D8PM87.pdb.gz	A0A1D8PM87_CANAL MAP kinase kinase kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSK2 PE=3 SV=1
8	AFDB:O23334	0.256	0.623	6.232E-15	364	0.090	0.231	O23334.pdb.gz	O23334_ARATH Kinase like protein OS=Arabidopsis thaliana OX=3702 GN=dl3430w PE=1 SV=1
9	AFDB:Q03526	0.252	0.369	1.377E-14	625	0.078	0.115	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
10	AFDB:Q9YI66	0.267	0.283	1.439E-14	874	0.067	0.071	Q9YI66.pdb.gz	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
11	PDB:1k9aB	0.248	0.509	5.726E-13	441	0.076	0.161	1k9aB.pdb.gz
12	PDB:4eomC	0.243	0.763	1.015E-12	276	0.067	0.225	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:8dksA	0.230	0.706	1.109E-12	283	0.079	0.258	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
14	PDB:4zhxA	0.240	0.525	1.159E-12	409	0.061	0.139	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:7myjC	0.242	0.465	2.923E-12	465	0.060	0.120	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:1unlA	0.228	0.673	3.644E-12	292	0.059	0.188	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:5ufuA	0.241	0.575	3.644E-12	369	0.062	0.157	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:5u6yA	0.243	0.475	4.159E-12	459	0.070	0.142	5u6yA.pdb.gz
19	PDB:6pjxA	0.247	0.409	4.960E-12	543	0.087	0.149	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:6byrA	0.229	0.500	5.417E-12	405	0.083	0.190	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4VSN1	0.0	1224	885	0.660	0.693	DUSTY_DANRE Dual serine/threonine and tyrosine protein kinase OS=Danio rerio OX=7955 GN=dstyk PE=2 SV=1
2	Q6XUX1	0.0	1686	927	0.913	0.915	DUSTY_MOUSE Dual serine/threonine and tyrosine protein kinase OS=Mus musculus OX=10090 GN=Dstyk PE=1 SV=1
3	Q6XUX3	0.0	1925	929	1.000	1.000	DUSTY_HUMAN Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens OX=9606 GN=DSTYK PE=1 SV=2
4	Q9FGB1	2.61e-24	108	385	0.078	0.187	Q9FGB1_ARATH Protein kinase OS=Arabidopsis thaliana OX=3702 GN=CBC2 PE=1 SV=1
5	O23334	7.88e-24	106	364	0.069	0.176	O23334_ARATH Kinase like protein OS=Arabidopsis thaliana OX=3702 GN=dl3430w PE=1 SV=1
6	Q9SSA4	5.34e-23	105	411	0.075	0.170	Q9SSA4_ARATH AT3g01490/F4P13_4 OS=Arabidopsis thaliana OX=3702 GN=CBC1 PE=1 SV=1
7	Q9LUI6	1.26e-21	100	378	0.067	0.164	Q9LUI6_ARATH Kinase-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g22750 PE=1 SV=1
8	Q0MSH9	6.41e-21	100	661	0.089	0.126	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
9	O22558	7.36e-21	99.8	546	0.067	0.114	STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana OX=3702 GN=STY8 PE=1 SV=2
10	A0A384KC16	1.24e-20	97.4	391	0.071	0.169	A0A384KC16_ARATH ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g57540 PE=1 SV=1
11	O22100	1.24e-20	97.4	391	0.071	0.169	O22100_ARATH ATMRK1 OS=Arabidopsis thaliana OX=3702 GN=ATMRK1 PE=1 SV=1
12	D3ZYL0	1.65e-20	99.4	658	0.086	0.122	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
13	Q9M085	1.17e-19	94.7	412	0.087	0.197	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
14	Q60855	1.99e-19	95.9	656	0.086	0.122	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
15	P07332	3.36e-19	95.5	822	0.093	0.105	FES_HUMAN Tyrosine-protein kinase Fes/Fps OS=Homo sapiens OX=9606 GN=FES PE=1 SV=3
16	P16879	3.36e-19	95.5	822	0.091	0.103	FES_MOUSE Tyrosine-protein kinase Fes/Fps OS=Mus musculus OX=10090 GN=Fes PE=1 SV=2
17	D4A584	3.53e-19	95.5	822	0.091	0.103	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
18	F4JTP5	2.35e-18	92.0	575	0.081	0.130	STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana OX=3702 GN=STY46 PE=1 SV=1
19	Q2MHE4	4.05e-18	89.7	390	0.072	0.172	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
20	Q54XQ2	4.27e-18	92.4	1125	0.058	0.048	RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum OX=44689 GN=rckA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2e+02	13.2	Phosphotransferase enzyme family
2	PF12330 Haspin_kinase	8.7	16.8	Haspin like kinase domain
3	PF06293 Kdo	23	15.8	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	73	14.1	Kinase-like
5	PF00069 Pkinase	3.5e-32	123.4	Protein kinase domain
6	PF17667 Pkinase_fungal	0.25	21.7	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	3.9e-32	123.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349459	0.765	Serine protease inhibitor Kazal-type 14
2	9606.ENSP00000356135	0.765	Transmembrane protein 81
3	9606.ENSP00000350718	0.751	Transmembrane and coiled-coil domains protein 2
4	9606.ENSP00000324870	0.717	Serine protease inhibitor Kazal-type 6
5	9606.ENSP00000443411	0.677	Protein FAM92B
6	9606.ENSP00000324920	0.673	Protein SIX6OS1
7	9606.ENSP00000309457	0.649	Vacuolar protein sorting-associated protein 41 homolog
8	9606.ENSP00000264515	0.634	Retinoblastoma-binding protein 5
9	9606.ENSP00000274276	0.634	Oncostatin-M-specific receptor subunit beta
10	9606.ENSP00000356256	0.612	Mitochondrial import inner membrane translocase subunit Tim17-A
11	9606.ENSP00000400591	0.602	Small nuclear ribonucleoprotein E
12	9606.ENSP00000226574	0.576	Nuclear factor NF-kappa-B p105 subunit
13	9606.ENSP00000220509	0.566	Vacuolar protein sorting-associated protein 18 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0016787	0.992	hydrolase activity
GO:0004674	0.943	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0009987	0.955	cellular process
GO:0048583	0.945	regulation of response to stimulus
GO:0048584	0.942	positive regulation of response to stimulus
GO:0048522	0.936	positive regulation of cellular process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0009966	0.910	regulation of signal transduction
GO:0050896	0.902	response to stimulus
GO:0009719	0.777	response to endogenous stimulus
GO:0048523	0.744	negative regulation of cellular process
GO:0009967	0.697	positive regulation of signal transduction
GO:0065009	0.667	regulation of molecular function
GO:0010941	0.612	regulation of cell death
GO:1902533	0.582	positive regulation of intracellular signal transduction
GO:0009893	0.539	positive regulation of metabolic process
GO:0043408	0.537	regulation of MAPK cascade
GO:0071704	0.528	organic substance metabolic process
GO:0043410	0.523	positive regulation of MAPK cascade
GO:0044238	0.510	primary metabolic process
GO:0051174	0.499	regulation of phosphorus metabolic process
GO:0071495	0.495	cellular response to endogenous stimulus
GO:0006807	0.490	nitrogen compound metabolic process
GO:0043170	0.458	macromolecule metabolic process
GO:0071840	0.449	cellular component organization or biogenesis
GO:0070848	0.437	response to growth factor
GO:0040036	0.426	regulation of fibroblast growth factor receptor signaling pathway
GO:0016043	0.411	cellular component organization
GO:0044237	0.399	cellular metabolic process
GO:0060255	0.399	regulation of macromolecule metabolic process
GO:0070372	0.387	regulation of ERK1 and ERK2 cascade
GO:0031325	0.386	positive regulation of cellular metabolic process
GO:0043067	0.364	regulation of programmed cell death
GO:0019220	0.345	regulation of phosphate metabolic process
GO:0042325	0.340	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0045177	0.990	apical part of cell
GO:0009925	0.989	basal plasma membrane
GO:0016323	0.934	basolateral plasma membrane
GO:0016324	0.923	apical plasma membrane
GO:0043229	0.302	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:3.-.-.-	0.992	Hydrolases.

[back to server]