StarFunc result for job id Q6XZF7

User Input

>input (1577 residues)
MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFTSQELDNLPLHRGDLVILDGIPTAGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALFQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNQDDCIVNGEVDTPVGEEEIGPDED
EEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLC
PDTRVEETMALPQEGSLARIPETSLDCLENTLGVEEQRHETSDHEAEEPDCIISEAPTSP
LGHLTSEYDTDRNSYQDEDTAGGPPRSPGVEWEMPLATDSPTSDPTEVVNGISSQPQVPF
HPNLQKSQYYSTVGGSHPHSEQYPDLLPLEARTRDYASLPPKRMYSQLKTLQKPVLPLYR
GSSVSASRVVKPRQSSPQLHNLASYTKKHHTSSVYSISERLEMKPGPQAQGLVMEAATHS
QGDGSTDLDSKLTQQLIEFEKSLAGPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQE
LPERRKALRPPPPRPCTPVSTSPHLLVDQNLKPAPPLVVRPSRPAPLPPSAQQRTNAVSP
KLLSRHRPTCETLEKEGPGHMGRSLDQTSPCPLVLVRIEEMERDLDMYSRAQEELNLMLE
EKQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSGSVSAENPEQR
MLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQ
LLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADL
KSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEI
NVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKD
EVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMERGHRDLEQF
ERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEK
LKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQ
LKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSAR
KPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDP
MGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSG
STLTFNPSSMAVSFTSGSCQKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPDS
TSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDLVKGCARTAQAP
EDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVN
GKKGYVPSNYIRKTEYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E2RP94	0.453	0.452	0.000	1583	0.833	0.830	E2RP94.pdb.gz	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
2	AFDB:E7F1U2	0.460	0.436	0.000	1673	0.529	0.499	E7F1U2.pdb.gz	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
3	AFDB:M0R4F8	0.519	0.519	0.000	1577	0.755	0.755	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
4	AFDB:Q6TXD4	0.581	0.580	0.000	1580	0.763	0.761	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
5	AFDB:Q6XZF7	1.000	1.000	0.000	1577	1.000	1.000	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
6	AFDB:A0A0B4KI34	0.060	0.082	9.207E-15	941	0.095	0.159	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
7	AFDB:Q5TCZ1	0.061	0.077	5.325E-13	1133	0.110	0.154	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
8	AFDB:E9Q7D5	0.126	0.126	4.085E-9	1581	0.103	0.103	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
9	PDB:7rx9A	0.110	0.388	1.579E-8	432	0.042	0.153	7rx9A.pdb.gz
10	PDB:4mt6A	0.113	0.433	6.595E-8	389	0.037	0.149	4mt6A.pdb.gz
11	PDB:1griA	0.052	0.288	2.630E-7	211	0.030	0.223	1griA.pdb.gz
12	PDB:2lqnA	0.043	0.181	2.884E-7	303	0.030	0.155	2lqnA.pdb.gz
13	AFDB:Q9VZ85	0.126	0.102	2.599E-6	1984	0.112	0.089	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
14	AFDB:Q86SQ0	0.056	0.066	4.956E-6	1253	0.102	0.128	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
15	PDB:2eyzA	0.042	0.198	1.747E-5	304	0.036	0.188	2eyzA.pdb.gz
16	PDB:2dybA	0.042	0.194	3.664E-4	298	0.019	0.101	2dybA.pdb.gz
17	PDB:3qwyA	0.037	0.326	2.786E-3	170	0.011	0.106	3qwyA.pdb.gz
18	PDB:4gouA	0.105	0.313	3.200E-3	507	0.030	0.093	4gouA.pdb.gz
19	PDB:3ehqA	0.040	0.292	4.220E-3	182	0.010	0.082	3ehqA.pdb.gz
20	PDB:1k9aB	0.035	0.124	7.684E-3	441	0.011	0.041	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2RP94	0.0	2560	1583	0.834	0.831	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
2	E7F1U2	0.0	1066	1673	0.346	0.326	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
3	M0R4F8	0.0	2248	1577	0.756	0.756	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
4	Q6TXD4	0.0	2268	1580	0.764	0.763	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
5	Q6XZF7	0.0	3253	1577	1.000	1.000	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
6	Q9NXL2	3.26e-133	434	777	0.163	0.331	ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38 PE=1 SV=2
7	G5ECK4	9.34e-30	131	1523	0.073	0.076	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
8	Q9TW28	2.24e-23	110	1737	0.047	0.043	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
9	Q91X43	2.68e-22	106	789	0.058	0.115	SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus OX=10090 GN=Sh3d19 PE=1 SV=2
10	Q69ZK0	1.97e-20	101	1650	0.044	0.042	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
11	D3ZS72	3.24e-20	100	1635	0.045	0.043	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
12	A0A8I6GLR6	3.56e-20	100	1646	0.045	0.043	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
13	A0A0U1RQE4	7.18e-20	99.4	1047	0.052	0.078	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
14	Q5HYK7	8.50e-20	98.6	790	0.052	0.104	SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2
15	Q8TCU6	9.91e-20	99.0	1659	0.046	0.043	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
16	A0A494C1M0	1.05e-19	98.6	1011	0.052	0.081	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
17	Q70Z35	8.09e-19	95.9	1606	0.041	0.040	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
18	Q3LAC4	8.50e-19	95.9	1598	0.042	0.041	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
19	Q15811	1.11e-17	92.4	1721	0.060	0.055	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
20	Q9NR81	1.11e-17	90.9	526	0.045	0.135	ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=ARHGEF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	3.1e-46	169.5	BAR domain
2	PF00621 RhoGEF	1e-32	125.4	RhoGEF domain
3	PF00018 SH3_1	3.2e-46	166.0	SH3 domain
4	PF07653 SH3_2	1.7e-39	144.7	Variant SH3 domain
5	PF08239 SH3_3	55	15.6	Bacterial SH3 domain
6	PF14604 SH3_9	6.8e-47	168.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315659

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.981	Cell division control protein 42 homolog
2	9606.ENSP00000223023	0.893	Neural Wiskott-Aldrich syndrome protein
3	9606.ENSP00000348461	0.758	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000249071	0.738	Ras-related C3 botulinum toxin substrate 2
5	9606.ENSP00000304283	0.731	Ras-related C3 botulinum toxin substrate 3
6	9606.ENSP00000337261	0.731	Rho guanine nucleotide exchange factor 1
7	9606.ENSP00000320924	0.703	WAS/WASL-interacting protein family member 2
8	9606.ENSP00000295095	0.678	Rho GTPase-activating protein 15
9	9606.ENSP00000276416	0.676	Bridging integrator 3
10	9606.ENSP00000222792	0.667	Beta-chimaerin
11	9606.ENSP00000386741	0.667	N-chimaerin
12	9606.ENSP00000264051	0.661	Ephexin-1
13	9606.ENSP00000362014	0.637	Dynamin-1
14	9606.ENSP00000364277	0.620	FYVE, RhoGEF and PH domain-containing protein 1
15	9606.ENSP00000471457	0.586	Unconventional myosin-IXb
16	9606.ENSP00000355809	0.578	Protein enabled homolog
17	9606.ENSP00000355026	0.556	Rho guanine nucleotide exchange factor 15
18	9606.ENSP00000356705	0.538	Dynamin-3
19	9606.ENSP00000394487	0.536	FYVE, RhoGEF and PH domain-containing protein 4
20	9606.ENSP00000403323	0.532	Rho GTPase-activating protein 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.361	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.974	regulation of cellular process
GO:0048583	0.894	regulation of response to stimulus
GO:0009987	0.879	cellular process
GO:0023051	0.832	regulation of signaling
GO:0009966	0.799	regulation of signal transduction
GO:0051056	0.777	regulation of small GTPase mediated signal transduction
GO:0022603	0.662	regulation of anatomical structure morphogenesis
GO:0022604	0.583	regulation of cell morphogenesis
GO:0071840	0.499	cellular component organization or biogenesis
GO:0016043	0.471	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005737	1.000	cytoplasm
GO:0005829	0.989	cytosol
GO:0070161	0.983	anchoring junction
GO:0043229	0.960	intracellular organelle
GO:0043227	0.908	membrane-bounded organelle
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0012505	0.618	endomembrane system
GO:0016020	0.608	membrane
GO:0005911	0.508	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]