StarFunc result for job id Q6Y1H2

User Input

>input (254 residues)
MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA
VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV
SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR
RKILSHTEEHKKFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Y1H2	1.000	1.000	3.699E-34	254	1.000	1.000	Q6Y1H2.pdb.gz	HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1
2	AFDB:B0YJ81	0.906	0.802	1.237E-22	288	0.591	0.521	B0YJ81.pdb.gz	HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens OX=9606 GN=HACD1 PE=1 SV=1
3	AFDB:Q9QY80	0.841	0.761	5.049E-22	281	0.547	0.495	Q9QY80.pdb.gz	HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus OX=10090 GN=Hacd1 PE=2 SV=1
4	AFDB:Q389R7	0.805	0.770	6.683E-13	266	0.291	0.278	Q389R7.pdb.gz	Q389R7_TRYB2 very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0290 PE=3 SV=1
5	AFDB:F4KGW0	0.740	0.811	8.061E-13	230	0.346	0.383	F4KGW0.pdb.gz	F4KGW0_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Arabidopsis thaliana OX=3702 GN=PAS2 PE=1 SV=1
6	AFDB:H3BS72	0.756	0.489	5.482E-11	400	0.232	0.147	H3BS72.pdb.gz	H3BS72_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
7	AFDB:O14346	0.759	0.922	7.262E-11	208	0.252	0.308	O14346.pdb.gz	HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.15c PE=3 SV=2
8	AFDB:Q8K2C9	0.759	0.538	7.611E-11	362	0.232	0.163	Q8K2C9.pdb.gz	HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus OX=10090 GN=Hacd3 PE=1 SV=2
9	AFDB:Q5VWC8	0.777	0.848	1.538E-10	232	0.213	0.233	Q5VWC8.pdb.gz	HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens OX=9606 GN=HACD4 PE=1 SV=1
10	AFDB:P40857	0.745	0.865	3.412E-10	217	0.280	0.327	P40857.pdb.gz	HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHS1 PE=1 SV=1
11	PDB:6y7fB	0.385	0.382	2.309E-2	256	0.126	0.125	6y7fB.pdb.gz	Crystal structure of human ELOVL fatty acid elongase 7 (ELOVL7)
12	PDB:7f1rR	0.178	0.149	7.076E-1	327	0.118	0.092	7f1rR.pdb.gz
13	PDB:7c9iC	0.201	0.206	1.079	243	0.087	0.091	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
14	PDB:7f1qR	0.220	0.165	1.079	367	0.130	0.090	7f1qR.pdb.gz
15	PDB:7khro	0.221	0.316	1.242	151	0.071	0.119	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
16	PDB:1keyB	0.178	0.196	1.570	221	0.079	0.090	1keyB.pdb.gz
17	PDB:7e33R	0.148	0.147	1.570	257	0.118	0.117	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:6puuA	0.147	0.048	1.894	1309	0.130	0.025	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
19	PDB:6w6l4	0.186	0.205	1.985	221	0.122	0.140	6w6l4.pdb.gz	An ER translocon for multi-pass membrane protein biogenesis.
20	PDB:6wv7B	0.138	0.103	2.080	388	0.091	0.059	6wv7B.pdb.gz	Structural basis of antagonizing the vitamin K catalytic cycle for anticoagulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6Y1H2	0.0	514	254	1.000	1.000	HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1
2	B0YJ81	5.19e-113	328	288	0.598	0.528	HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens OX=9606 GN=HACD1 PE=1 SV=1
3	Q9QY80	2.43e-112	326	281	0.563	0.509	HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus OX=10090 GN=Hacd1 PE=2 SV=1
4	F4KGW0	5.09e-46	155	230	0.350	0.387	F4KGW0_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Arabidopsis thaliana OX=3702 GN=PAS2 PE=1 SV=1
5	Q389R7	3.40e-37	133	266	0.299	0.286	Q389R7_TRYB2 very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0290 PE=3 SV=1
6	P40857	7.94e-27	105	217	0.280	0.327	HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHS1 PE=1 SV=1
7	H3BRL8	4.46e-26	103	245	0.256	0.265	H3BRL8_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
8	H3BPZ1	1.39e-25	104	337	0.248	0.187	H3BPZ1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
9	O14346	1.69e-25	101	208	0.287	0.351	HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.15c PE=3 SV=2
10	Q9P035	3.01e-25	104	362	0.248	0.174	HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2
11	H3BS72	3.46e-25	104	400	0.248	0.158	H3BS72_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1
12	Q8K2C9	9.22e-25	102	362	0.287	0.202	HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus OX=10090 GN=Hacd3 PE=1 SV=2
13	Q5VWC8	2.20e-19	85.9	232	0.256	0.280	HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens OX=9606 GN=HACD4 PE=1 SV=1
14	Q21905	0.020	37.7	202	0.146	0.183	Q21905_CAEEL Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Caenorhabditis elegans OX=6239 GN=CELE_R10E4.9 PE=3 SV=1
15	Q12389	3.3	31.6	995	0.055	0.014	DBP10_YEAST ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP10 PE=1 SV=2
16	F4K704	3.7	31.6	833	0.071	0.022	F4K704_ARATH LA RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
17	Q940X9	3.7	31.6	826	0.071	0.022	LRP1A_ARATH La-related protein 1A OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
18	Q385E7	4.2	31.2	578	0.138	0.061	Q385E7_TRYB2 Palmitoyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4090 PE=3 SV=1
19	Q09719	5.6	30.8	848	0.055	0.017	DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp10 PE=1 SV=1
20	Q9C0I9	9.6	30.0	530	0.047	0.023	LRC27_HUMAN Leucine-rich repeat-containing protein 27 OS=Homo sapiens OX=9606 GN=LRRC27 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04387 PTPLA	1.8e-53	192.0	Protein tyrosine phosphatase-like protein, PTPLA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215567	0.993	Very-long-chain enoyl-CoA reductase
2	9606.ENSP00000278353	0.974	Very-long-chain 3-oxoacyl-CoA reductase
3	9606.ENSP00000378105	0.939	Elongation of very long chain fatty acids protein 6
4	9606.ENSP00000358831	0.904	Elongation of very long chain fatty acids protein 4
5	9606.ENSP00000316329	0.878	Stearoyl-CoA desaturase 5
6	9606.ENSP00000359380	0.869	Acyl-CoA desaturase
7	9606.ENSP00000346693	0.867	Elongation of very long chain fatty acids protein 2
8	9606.ENSP00000322229	0.848	Fatty acid desaturase 1
9	9606.ENSP00000261875	0.834	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
10	9606.ENSP00000419503	0.834	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
11	9606.ENSP00000355308	0.804	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1
12	9606.ENSP00000286808	0.614	Claudin-17
13	9606.ENSP00000316905	0.604	Sideroflexin-1
14	9606.ENSP00000392330	0.597	B-cell receptor-associated protein 31
15	9606.ENSP00000385790	0.572	Serine dehydratase-like
16	9606.ENSP00000257549	0.560	L-serine dehydratase/L-threonine deaminase
17	9606.ENSP00000329548	0.545	Tumor suppressor candidate 5
18	9606.ENSP00000370607	0.540	trans-2,3-enoyl-CoA reductase like
19	9606.ENSP00000219439	0.539	Inactive hydroxysteroid dehydrogenase-like protein 1
20	9606.ENSP00000363345	0.529	Thymic stromal cotransporter homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0080023	1.000	3R-hydroxyacyl-CoA dehydratase activity
GO:0018812	1.000	3-hydroxyacyl-CoA dehydratase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0072521	0.995	purine-containing compound metabolic process
GO:0042761	0.990	very long-chain fatty acid biosynthetic process
GO:0006163	0.989	purine nucleotide metabolic process
GO:0035383	0.988	thioester metabolic process
GO:0033875	0.988	ribonucleoside bisphosphate metabolic process
GO:0009260	0.988	ribonucleotide biosynthetic process
GO:0072522	0.986	purine-containing compound biosynthetic process
GO:0030497	0.964	fatty acid elongation
GO:0006637	0.959	acyl-CoA metabolic process
GO:0071616	0.948	acyl-CoA biosynthetic process
GO:1901568	0.929	fatty acid derivative metabolic process
GO:0006643	0.928	membrane lipid metabolic process
GO:1901570	0.903	fatty acid derivative biosynthetic process
GO:0035337	0.901	fatty-acyl-CoA metabolic process
GO:0006665	0.827	sphingolipid metabolic process
GO:0046467	0.793	membrane lipid biosynthetic process
GO:0030148	0.784	sphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.

[back to server]