StarFunc result for job id Q6Y7W6

User Input

>input (1299 residues)
MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPS
DLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLTGRGGGGTVVGAPRGR
SSSRGRGRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRP
NFEEGGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPDGP
RSAGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTF
DSSGAFLSLKKVQKEPIPEEQEMDFRPVDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTD
RVGVEASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPA
KVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVST
EPDDEEGLKHLEQQAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKD
PQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPP
HMGELDQERLTRQQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLL
QQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPLDTTTPG
PALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRR
EEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELL
RKQEEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQ
QQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQSQATLSLAEIQKLEEERERQL
REEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQ
QQHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWD
DAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCE
QMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKA
NQQRQQQQLPQQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQS
GKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Y7W6	1.000	1.000	0.000	1299	1.000	1.000	Q6Y7W6.pdb.gz	GGYF2_HUMAN GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
2	AFDB:Q99MR1	0.093	0.114	1.936E-76	1044	0.442	0.550	Q99MR1.pdb.gz	GGYF1_MOUSE GRB10-interacting GYF protein 1 OS=Mus musculus OX=10090 GN=Gigyf1 PE=1 SV=2
3	AFDB:Q7KQM6	0.069	0.059	1.811E-31	1574	0.252	0.208	Q7KQM6.pdb.gz	GGYF1_DROME GIGYF family protein Gyf OS=Drosophila melanogaster OX=7227 GN=Gyf PE=1 SV=2
4	AFDB:Q86UU1	0.071	0.068	1.448E-6	1377	0.150	0.142	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
5	AFDB:A8JNK1	0.067	0.070	2.377E-5	1241	0.142	0.148	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
6	AFDB:Q9VED3	0.050	0.052	1.198E-4	1186	0.128	0.140	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
7	AFDB:Q54DK4	0.038	0.037	1.534E-3	1352	0.080	0.077	Q54DK4.pdb.gz	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
8	AFDB:Q9FMM3	0.058	0.045	1.534E-3	1714	0.132	0.100	Q9FMM3.pdb.gz	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
9	AFDB:D3Z8E6	0.033	0.028	2.684E-3	1604	0.123	0.100	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
10	AFDB:Q8SY33	0.043	0.042	6.822E-3	1384	0.123	0.116	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
11	PDB:7oopV	0.018	0.074	3.733	217	0.012	0.069	7oopV.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:6n7pA	0.030	0.140	5.421	186	0.013	0.091	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
13	PDB:5c0wK	0.025	0.052	6.952	576	0.010	0.023	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
14	PDB:5z1fA	0.034	0.061	7.399	601	0.006	0.013	5z1fA.pdb.gz
15	PDB:6fvtJ	0.039	0.083	8.378	405	0.015	0.049	6fvtJ.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
16	PDB:2rvqD	0.037	0.230	9.488	129	0.014	0.140	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JHW1	0.0	1448	720	0.554	1.000	C9JHW1_HUMAN GRB10 interacting GYF protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
2	E7ESB6	0.0	1693	836	0.644	1.000	E7ESB6_HUMAN GRB10 interacting GYF protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
3	I1E4Y6	0.0	2619	1321	1.000	0.983	I1E4Y6_HUMAN GRB10 interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
4	Q6Y7W6	0.0	2631	1299	1.000	1.000	GGYF2_HUMAN GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1
5	Q6Y7W8	0.0	1896	1291	0.939	0.945	GGYF2_MOUSE GRB10-interacting GYF protein 2 OS=Mus musculus OX=10090 GN=Gigyf2 PE=1 SV=2
6	Q99MR1	9.84e-118	395	1044	0.169	0.210	GGYF1_MOUSE GRB10-interacting GYF protein 1 OS=Mus musculus OX=10090 GN=Gigyf1 PE=1 SV=2
7	O75420	2.83e-62	234	1035	0.125	0.157	GGYF1_HUMAN GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2
8	Q7KQM6	2.82e-32	139	1574	0.131	0.108	GGYF1_DROME GIGYF family protein Gyf OS=Drosophila melanogaster OX=7227 GN=Gyf PE=1 SV=2
9	A1Z8M2	1.63e-09	65.5	2999	0.037	0.016	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
10	A8DYA3	1.67e-09	65.1	3131	0.037	0.015	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
11	Q8IDX6	1.67e-09	65.1	3130	0.054	0.022	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
12	Q02875	2.04e-05	51.6	849	0.062	0.094	SYH1_YEAST SMY2 homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYH1 PE=1 SV=1
13	Q9HD67	3.61e-05	50.8	2058	0.033	0.021	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
14	A0A0A0MQX1	3.80e-05	50.8	2069	0.033	0.021	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
15	E9PEW5	9.14e-05	49.7	1397	0.033	0.031	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
16	Q1MTN9	1.66e-04	48.1	544	0.028	0.066	RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rlf2 PE=1 SV=2
17	Q54P24	3.69e-04	47.4	1215	0.050	0.053	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
18	Q15149	5.56e-04	47.0	4684	0.059	0.016	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
19	P33332	7.56e-04	46.6	1336	0.030	0.029	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
20	G4SLH0	0.001	45.8	18562	0.038	0.003	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02213 GYF	9.4e-18	74.9	GYF domain
2	PF14237 GYF_2	0.014	26.4	GYF domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003813183.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813192.1	0.977	Belongs to the eukaryotic initiation factor 4E family.
2	9597.XP_003807750.1	0.950	Zinc finger protein 598
3	9597.XP_008961122.1	0.839	Growth factor receptor bound protein 10
4	9597.XP_008964243.1	0.787	CCR4-NOT transcription complex subunit 4 isoform X1
5	9597.XP_003820080.1	0.771	DEAD-box helicase 6
6	9597.XP_008961960.1	0.694	Cyclin G associated kinase
7	9597.XP_003828191.1	0.683	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
8	9597.XP_008977013.1	0.674	Ataxin-2-like protein
9	9597.XP_008953808.1	0.673	CCR4-NOT transcription complex subunit 3 isoform X1
10	9597.XP_008953567.1	0.672	Belongs to the eukaryotic initiation factor 4E family.
11	9597.XP_008962055.1	0.662	Eukaryotic translation initiation factor 3 subunit J
12	9597.XP_003828633.1	0.661	Splicing factor 1 isoform X1
13	9597.XP_008968588.1	0.644	Integrator complex subunit 3
14	9597.XP_008965374.1	0.617	Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type V subfamily
15	9597.XP_003812290.1	0.612	ZFP36 ring finger protein
16	9597.XP_008956311.1	0.611	Belongs to the eukaryotic initiation factor 4E family.
17	9597.XP_008973447.1	0.597	Ubiquitin protein ligase E3 component n-recognin 5
18	9597.XP_008975601.1	0.582	CCR4-NOT transcription complex subunit 1
19	9597.XP_008953570.1	0.562	Eukaryotic translation initiation factor 4 gamma 1 isoform X1
20	9597.XP_003829253.1	0.561	Catenin alpha 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.992	RNA binding
GO:0050839	0.934	cell adhesion molecule binding
GO:0045296	0.924	cadherin binding
GO:0070064	0.922	proline-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	1.000	regulation of cellular process
GO:0009987	0.999	cellular process
GO:0050896	0.975	response to stimulus
GO:0048523	0.975	negative regulation of cellular process
GO:0007165	0.965	signal transduction
GO:0007169	0.957	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048009	0.953	insulin-like growth factor receptor signaling pathway
GO:0031323	0.911	regulation of cellular metabolic process
GO:0060255	0.903	regulation of macromolecule metabolic process
GO:0010468	0.893	regulation of gene expression
GO:0051171	0.885	regulation of nitrogen compound metabolic process
GO:0080090	0.884	regulation of primary metabolic process
GO:0048522	0.876	positive regulation of cellular process
GO:0051246	0.857	regulation of protein metabolic process
GO:0010605	0.857	negative regulation of macromolecule metabolic process
GO:0051172	0.854	negative regulation of nitrogen compound metabolic process
GO:0031324	0.854	negative regulation of cellular metabolic process
GO:0009893	0.847	positive regulation of metabolic process
GO:0010556	0.845	regulation of macromolecule biosynthetic process
GO:0031326	0.845	regulation of cellular biosynthetic process
GO:0051173	0.841	positive regulation of nitrogen compound metabolic process
GO:0019219	0.841	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.833	positive regulation of macromolecule metabolic process
GO:0031325	0.831	positive regulation of cellular metabolic process
GO:0010608	0.748	post-transcriptional regulation of gene expression
GO:0031329	0.747	regulation of cellular catabolic process
GO:0051248	0.747	negative regulation of protein metabolic process
GO:0051252	0.746	regulation of RNA metabolic process
GO:0010629	0.711	negative regulation of gene expression
GO:0010558	0.703	negative regulation of macromolecule biosynthetic process
GO:0031327	0.700	negative regulation of cellular biosynthetic process
GO:2000112	0.693	regulation of cellular macromolecule biosynthetic process
GO:0065008	0.628	regulation of biological quality
GO:0071704	0.509	organic substance metabolic process
GO:0006417	0.496	regulation of translation
GO:0044238	0.464	primary metabolic process
GO:0006807	0.452	nitrogen compound metabolic process
GO:0045935	0.428	positive regulation of nucleobase-containing compound metabolic process
GO:0043170	0.381	macromolecule metabolic process
GO:0051254	0.362	positive regulation of RNA metabolic process
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.939	membrane
GO:0043227	0.877	membrane-bounded organelle
GO:0043231	0.864	intracellular membrane-bounded organelle
GO:0120025	0.692	plasma membrane bounded cell projection
GO:0031982	0.692	vesicle
GO:0043005	0.598	neuron projection
GO:0044297	0.515	cell body
GO:0030425	0.485	dendrite
GO:0005634	0.484	nucleus
GO:0032991	0.457	protein-containing complex
GO:0043204	0.438	perikaryon
GO:0010494	0.388	cytoplasmic stress granule
GO:0005768	0.385	endosome
GO:0005794	0.384	Golgi apparatus
GO:0005783	0.384	endoplasmic reticulum
GO:1990635	0.382	proximal dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]