StarFunc result for job id Q6YHK3

User Input

>input (1445 residues)
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKA
ELLKTASNLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNST
RLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SQQSDLGVISKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCS
MNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKINGSANFSFNDEEMK
NVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVL
KPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINY
TVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVG
SPFELVVSGNKRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDG
EIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMN
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLTKDYIDGVYDNAEY
AERFMEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTNMGYRIYQEFEVTVPDSITSW
VATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEV
KVIIEKSDKFDILMTSNEINATGHQQTLLVPSEDGATVLFPIRPTHLGEIPITVTALSPT
ASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAI
GDVLGPSINGLASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQG
YQRELLYQREDGSFSAFGNYDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGH
QKSNGEFWDPGRVIHSELQGGNKSPVTLTAYIVTSLLGYRKYQPNIDVQESIHFLESEFS
RGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSL
DIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKALSEFAALMNT
ERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVV
YNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNL
LSGFMVPSEAISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVS
IVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHHSSVIFIFCFKLLYF
MELWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01023	0.844	0.828	0.000	1474	0.282	0.277	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
2	AFDB:P28665	0.836	0.819	0.000	1476	0.281	0.275	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
3	AFDB:Q61838	0.830	0.803	0.000	1495	0.268	0.259	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
4	AFDB:Q6YHK3	1.000	1.000	0.000	1445	1.000	1.000	Q6YHK3.pdb.gz	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
5	AFDB:Q8IZJ3	0.847	0.656	0.000	1885	0.311	0.239	Q8IZJ3.pdb.gz	CPMD8_HUMAN C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2
6	AFDB:Q8R422	0.951	0.953	0.000	1442	0.722	0.724	Q8R422.pdb.gz	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
7	AFDB:Q9NFV7	0.834	0.849	0.000	1420	0.293	0.299	Q9NFV7.pdb.gz	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
8	AFDB:Q9NFV8	0.834	0.888	0.000	1354	0.280	0.299	Q9NFV8.pdb.gz	Q9NFV8_DROME TEP1 protein OS=Drosophila melanogaster OX=7227 GN=Tep1 PE=2 SV=1
9	AFDB:Q9VLY7	0.809	0.796	0.000	1469	0.273	0.268	Q9VLY7.pdb.gz	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
10	AFDB:Q03626	0.832	0.809	4.349E-104	1487	0.284	0.276	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
11	PDB:7q1yA	0.782	0.820	2.595E-97	1374	0.271	0.285	7q1yA.pdb.gz
12	PDB:7q5zA	0.767	0.821	4.611E-90	1344	0.268	0.288	7q5zA.pdb.gz
13	PDB:4lnvA	0.631	0.707	2.908E-87	1276	0.232	0.263	4lnvA.pdb.gz
14	PDB:7vonA	0.788	0.813	6.343E-83	1399	0.268	0.277	7vonA.pdb.gz
15	PDB:4lnvB	0.598	0.794	3.978E-67	1063	0.220	0.299	4lnvB.pdb.gz
16	PDB:7nycA	0.441	0.416	9.751E-67	1542	0.221	0.208	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:6h03A	0.438	0.511	4.814E-60	1223	0.196	0.231	6h03A.pdb.gz
18	PDB:5a42A	0.507	0.465	1.486E-53	1597	0.141	0.128	5a42A.pdb.gz
19	PDB:4ziqA	0.321	0.320	7.592E-50	1450	0.139	0.139	4ziqA.pdb.gz
20	PDB:4rtdA	0.313	0.382	5.054E-43	1122	0.125	0.160	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6YHK3	0.0	2992	1445	1.000	1.000	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
2	Q8R422	0.0	2167	1442	0.724	0.725	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
3	Q9NFV7	0.0	615	1420	0.302	0.308	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
4	A8K2U0	7.30e-160	523	1454	0.291	0.289	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
5	Q9NFV5	1.29e-155	512	1496	0.304	0.293	Q9NFV5_DROME TEP4 protein OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=2 SV=1
6	Q9VIT9	2.92e-155	511	1496	0.304	0.293	Q9VIT9_DROME Thioester-containing protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=2
7	Q7SIH1	3.87e-155	511	1510	0.313	0.300	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
8	Q9NFV8	6.25e-155	507	1354	0.278	0.297	Q9NFV8_DROME TEP1 protein OS=Drosophila melanogaster OX=7227 GN=Tep1 PE=2 SV=1
9	M9PDR0	1.95e-154	509	1498	0.304	0.293	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
10	M9PD73	2.95e-154	508	1476	0.300	0.293	M9PD73_DROME Thioester-containing protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
11	Q9NFV6	5.96e-154	507	1469	0.286	0.281	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
12	Q9VLY7	1.61e-153	506	1469	0.286	0.281	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
13	M9PDF6	2.20e-153	506	1478	0.300	0.293	M9PDF6_DROME Thioester-containing protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
14	P20742	2.27e-149	494	1482	0.296	0.288	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
15	P06238	3.94e-147	488	1472	0.291	0.285	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
16	Q6GQT1	4.12e-147	488	1474	0.295	0.289	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
17	Q61838	5.21e-146	486	1495	0.280	0.271	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
18	Q63041	1.96e-141	473	1500	0.296	0.285	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
19	P01023	4.39e-138	463	1474	0.301	0.295	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
20	B8QSI4	3.04e-130	441	1442	0.284	0.285	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.3e-24	97.1	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.4e-19	82.3	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	8.6e-21	85.7	A-macroglobulin receptor binding domain
4	PF01835 MG2	1.7e-11	55.7	MG2 domain
5	PF17791 MG3	1.9e-17	74.7	Macroglobulin domain MG3
6	PF17789 MG4	1.5e+02	14.1	Macroglobulin domain MG4
7	PF07678 TED_complement	7.3e-89	309.4	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339191	0.737	Caveolin-1
2	9606.ENSP00000452786	0.684	Integrin beta-3
3	9606.ENSP00000262158	0.679	Mothers against decapentaplegic homolog 7
4	9606.ENSP00000287474	0.646	Ferric-chelate reductase 1
5	9606.ENSP00000262407	0.622	Integrin alpha-IIb
6	9606.ENSP00000483552	0.539	Furin
7	9606.ENSP00000344465	0.509	Platelet endothelial aggregation receptor 1
8	9606.ENSP00000372210	0.507	BET1-like protein
9	9606.ENSP00000275493	0.500	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	0.999	growth factor binding
GO:0019955	0.997	cytokine binding
GO:0098772	0.908	molecular function regulator activity
GO:0050431	0.897	transforming growth factor beta binding
GO:0030234	0.335	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0048523	0.922	negative regulation of cellular process
GO:0048583	0.839	regulation of response to stimulus
GO:0023051	0.806	regulation of signaling
GO:0010646	0.806	regulation of cell communication
GO:0009966	0.802	regulation of signal transduction
GO:0050896	0.749	response to stimulus
GO:0090287	0.740	regulation of cellular response to growth factor stimulus
GO:0048585	0.738	negative regulation of response to stimulus
GO:0080134	0.737	regulation of response to stress
GO:0090092	0.700	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.691	negative regulation of signal transduction
GO:1903844	0.672	regulation of cellular response to transforming growth factor beta stimulus
GO:1903034	0.658	regulation of response to wounding
GO:0009987	0.632	cellular process
GO:0017015	0.594	regulation of transforming growth factor beta receptor signaling pathway
GO:0090101	0.562	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903035	0.426	negative regulation of response to wounding
GO:0061041	0.401	regulation of wound healing
GO:0030512	0.378	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0048518	0.377	positive regulation of biological process
GO:0032502	0.340	developmental process
GO:0048856	0.326	anatomical structure development
GO:0019222	0.325	regulation of metabolic process
GO:0032501	0.313	multicellular organismal process
GO:0006950	0.300	response to stress
GO:0032101	0.300	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.998	membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031982	0.993	vesicle
GO:0005737	0.990	cytoplasm
GO:0005886	0.985	plasma membrane
GO:0031090	0.977	organelle membrane
GO:0098588	0.957	bounding membrane of organelle
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0030659	0.923	cytoplasmic vesicle membrane
GO:0030667	0.894	secretory granule membrane
GO:0009986	0.853	cell surface
GO:0005615	0.835	extracellular space
GO:0005829	0.813	cytosol
GO:0031091	0.775	platelet alpha granule
GO:0043230	0.669	extracellular organelle
GO:1903561	0.534	extracellular vesicle
GO:0070062	0.523	extracellular exosome
GO:0070013	0.481	intracellular organelle lumen
GO:0032991	0.438	protein-containing complex
GO:0098796	0.334	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]