StarFunc result for job id Q6YHU6

User Input

>input (1953 residues)
MGVKKKKEMQVAALTICHQDLETLKSFADVEGKNLASLLLHCVQLTDGVSQIHYIKQIVP
LLEKADKNGMCDPTIQSCLDILAGIYLSLSLKNPLKKVLASSLNSLPDFFLPEAMHRFTS
RLQEELNTTDLYSYRKVTDNISSCMENFNLGRASVNNLLKNVLHFLQKSLIEILEENRKC
AGNHIIQTQLMNDLLVGIRVSMMLVQKVQDFQGNLWKTSDSPIWQNMCGLLSIFTKVLSD
DDLLQTVQSTSGLAIILFIKTMFHPSEKIPHLISSVLLRSVDCTSVPEWFMSSCRSLCCG
DISQSAVLFLCQGTLAMLDWQNGSMGRSGEALLLDTAHVLFTLSSQIKEPTLEMFLSRIL
ASWTNSAIQVLESSSPSLTDSLNGNSSIVGRLLEYVYTHWEHPLDALRHQTKIMFKNLLQ
MHRLTVEGADFVPDPFFVELTESLLRLEWHIKGKYTCLGCLVECIGVEHILAIDKTIPSQ
ILEVMGDQSLVPYASDLLETMFRNHKSHLKSQTAESSWIDQWHETWVSPLLFILCEGNLD
QKSYVIDYYLPKLLSYSPESLQYMVKILQTSIDAKTGQEQSFPSLGSCNSRGALGALMAC
LRIARAHGHLQSATDTWENLVSDARIKQGLIHQHCQVRIDTLGLLCESNRSTEIVSMEEM
QWIQFFITYNLNSQSPGVRQQICSLLKKLFCRIQESSQVLYKLEQSKSKREPENELTKQH
PSVSLQQYKNFMSSICNSLFEALFPGSSYSTRFSALTILGSIAEVFHVPEGRIYTVYQLS
HDIDVGRFQTLMECFTSTFEDVKILAFDLLMKLSKTAVHFQDSGKLQGLFQAALELSTST
KPYDCVTASYLLNFLIWQDALPSSLSAYLTQQVACDNGDRPAAVVERNTLMVIKCLMENL
EEEVSQAENSLLQAAAAFPMYGRVHCITGALQKLSLNSLQLVSEWRPVVEKLLLMSYRLS
TVVSPVIQSSSPEGLIPMDTDSESASRLQMILNEIQPRDTNDYFNQAKILKEHDSFDMKD
LNASVVNIDTSTEIKGKEVKTCDVTAQMVLVCCWRSMKEVALLLGMLCQLLPMQPVPESS
DGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLW
SVLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLLKITMKELISLAGPTDD
IQSTVPQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSAL
ITRIFGVKRAKDEHSKTNRMTGREFFSRFPELYPFLLKQLETVANTVDSDMGEPNRHPSM
FLLLLVLERLYASPMDGTSSALSMGPFVPFIMRCGHSPVYHSREMAARALVPFVMIDHIP
NTIRTLLSTLPSCTDQCFRQNHIHGTLLQVFHLLQAYSDSKHGTNSDFQHELTDITVCTK
AKLWLAKRQNPCLVTRAVYIDILFLLTCCLNRSAKDNQPVLESLGFWEEVRGIISGSELI
TGFPWAFKVPGLPQYLQSLTRLAIAAVWAAAAKSGERETNVPISFSQLLESAFPEVRSLT
LEALLEKFLAAASGLGEKGVPPLLCNMGEKFLLLAMKENHPECFCKILKILHCMDPGEWL
PQTEHCVHLTPKEFLIWTMDIASNERSEIQSVALRLASKVISHHMQTCVENRELIAAELK
QWVQLVILSCEDHLPTESRLAVVEVLTSTTPLFLTNPHPILELQDTLALWKCVLTLLQSE
EQAVRDAATETVTTAMSQENTCQSTEFAFCQVDASIALALALAVLCDLLQQWDQLAPGLP
ILLGWLLGESDDLVACVESMHQVEEDYLFEKAEVNFWAETLIFVKYLCKHLFCLLSKSGW
RPPSPEMLCHLQRMVSEQCHLLSQFFRELPPAAEFVKTVEFTRLRIQEERTLACLRLLAF
LEGKEGEDTLVLSVWDSYAESRQLTLPRTEAAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QTW7	0.876	0.891	0.000	1919	0.414	0.421	F1QTW7.pdb.gz
2	AFDB:Q6YHU6	1.000	1.000	0.000	1953	1.000	1.000	Q6YHU6.pdb.gz	THADA_HUMAN tRNA (32-2'-O)-methyltransferase regulator THADA OS=Homo sapiens OX=9606 GN=THADA PE=1 SV=1
3	AFDB:F4JFA0	0.757	0.699	2.767E-52	2130	0.201	0.185	F4JFA0.pdb.gz	F4JFA0_ARATH Thyroid adenoma-associated-like protein OS=Arabidopsis thaliana OX=3702 GN=THADA PE=1 SV=1
4	AFDB:Q9VWB9	0.513	0.566	5.144E-46	1746	0.194	0.216	Q9VWB9.pdb.gz	THADA_DROME tRNA (32-2'-O)-methyltransferase regulator THADA OS=Drosophila melanogaster OX=7227 GN=THADA PE=1 SV=3
5	AFDB:O60081	0.577	0.728	1.448E-36	1502	0.154	0.200	O60081.pdb.gz	THADA_SCHPO tRNA (32-2'-O)-methyltransferase regulator trm732 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm732 PE=3 SV=1
6	AFDB:Q03496	0.592	0.792	1.345E-33	1420	0.138	0.190	Q03496.pdb.gz	THADA_YEAST tRNA (32-2'-O)-methyltransferase regulator TRM732 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM732 PE=1 SV=1
7	AFDB:Q38DI9	0.669	0.631	6.926E-33	2086	0.155	0.145	Q38DI9.pdb.gz	Q38DI9_TRYB2 DUF2428 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3160 PE=3 SV=1
8	AFDB:Q10105	0.128	0.108	1.508E-13	2670	0.162	0.118	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
9	AFDB:B3CJ34	0.134	0.111	2.634E-13	2634	0.145	0.107	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
10	AFDB:P33892	0.127	0.104	1.454E-12	2672	0.136	0.099	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
11	PDB:7mq8SP	0.119	0.118	1.108E-10	1993	0.115	0.113	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaSP	0.160	0.138	1.464E-10	2485	0.133	0.105	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7sglA	0.119	0.086	2.075E-10	3852	0.152	0.077	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
14	PDB:7sukSP	0.138	0.124	4.627E-10	2234	0.131	0.114	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:7ajuUT	0.144	0.130	7.538E-10	2313	0.138	0.117	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7k1nA	0.129	0.081	9.622E-10	3634	0.137	0.074	7k1nA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
17	PDB:7mqaLM	0.106	0.102	1.068E-9	2041	0.130	0.124	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7r04B	0.127	0.115	2.001E-9	2229	0.124	0.109	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
19	PDB:6ez8A	0.141	0.124	2.146E-9	2353	0.147	0.122	6ez8A.pdb.gz
20	PDB:6yejA	0.143	0.138	2.467E-9	2046	0.135	0.129	6yejA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6YHU6	0.0	4026	1953	1.000	1.000	THADA_HUMAN tRNA (32-2'-O)-methyltransferase regulator THADA OS=Homo sapiens OX=9606 GN=THADA PE=1 SV=1
2	Q9VWB9	5.90e-74	276	1746	0.118	0.132	THADA_DROME tRNA (32-2'-O)-methyltransferase regulator THADA OS=Drosophila melanogaster OX=7227 GN=THADA PE=1 SV=3
3	F4JFA0	2.96e-67	255	2130	0.143	0.131	F4JFA0_ARATH Thyroid adenoma-associated-like protein OS=Arabidopsis thaliana OX=3702 GN=THADA PE=1 SV=1
4	O60081	4.57e-56	218	1502	0.127	0.165	THADA_SCHPO tRNA (32-2'-O)-methyltransferase regulator trm732 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm732 PE=3 SV=1
5	Q5BLB0	1.43e-47	177	364	0.055	0.297	Q5BLB0_DANRE Thyroid adenoma-associated protein OS=Danio rerio OX=7955 GN=zgc:113068 PE=1 SV=1
6	Q03496	6.47e-27	122	1420	0.071	0.097	THADA_YEAST tRNA (32-2'-O)-methyltransferase regulator TRM732 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM732 PE=1 SV=1
7	Q38DI9	8.42e-10	67.0	2086	0.044	0.041	Q38DI9_TRYB2 DUF2428 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3160 PE=3 SV=1
8	Q5Z5I4	0.026	41.6	455	0.012	0.051	GLK1_ORYSJ Probable transcription factor GLK1 OS=Oryza sativa subsp. japonica OX=39947 GN=GLK1 PE=2 SV=1
9	Q9FFH0	0.038	41.2	386	0.012	0.062	GLK2_ARATH Transcription activator GLK2 OS=Arabidopsis thaliana OX=3702 GN=GLK2 PE=1 SV=1
10	Q9SIV3	0.088	40.0	420	0.011	0.052	GLK1_ARATH Transcription activator GLK1 OS=Arabidopsis thaliana OX=3702 GN=GLK1 PE=1 SV=2
11	F4IVF9	0.090	40.0	436	0.011	0.050	F4IVF9_ARATH GBF's pro-rich region-interacting factor 1 OS=Arabidopsis thaliana OX=3702 GN=GPRI1 PE=1 SV=1
12	Q08379	2.9	35.4	1002	0.017	0.034	GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3
13	Q29406	2.9	33.9	167	0.009	0.102	LEP_PIG Leptin OS=Sus scrofa OX=9823 GN=LEP PE=2 SV=1
14	B7ZC06	3.0	35.4	997	0.017	0.034	B7ZC06_HUMAN Golgin A2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=4
15	P51811	3.9	34.7	444	0.012	0.054	XK_HUMAN Endoplasmic reticulum membrane adapter protein XK OS=Homo sapiens OX=9606 GN=XK PE=1 SV=5
16	Q8T0H3	9.7	33.5	562	0.012	0.043	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10350 DUF2428	2e-96	334.1	THADA/TRM732, DUF2428
2	PF02985 HEAT	0.00043	31.3	HEAT repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326948	0.895	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
2	9606.ENSP00000281141	0.888	Cell division cycle protein 123 homolog
3	9606.ENSP00000362727	0.851	DENN domain-containing protein 1A
4	9606.ENSP00000348596	0.834	Protein SDA1 homolog
5	9606.ENSP00000283928	0.804	Juxtaposed with another zinc finger protein 1
6	9606.ENSP00000452780	0.800	Beta-2-microglobulin
7	9606.ENSP00000282728	0.784	Hematopoietically-expressed homeobox protein HHEX
8	9606.ENSP00000377668	0.770	Sulfite oxidase, mitochondrial
9	9606.ENSP00000238146	0.763	ATP-dependent RNA helicase DDX55
10	9606.ENSP00000377003	0.746	Tetraspanin-8
11	9606.ENSP00000418735	0.740	A disintegrin and metalloproteinase with thrombospondin motifs 9
12	9606.ENSP00000274695	0.739	Threonylcarbamoyladenosine tRNA methylthiotransferase
13	9606.ENSP00000226760	0.732	Wolframin
14	9606.ENSP00000378857	0.731	WD repeat-containing protein 6
15	9606.ENSP00000478874	0.722	Calcium/calmodulin-dependent protein kinase type 1D
16	9606.ENSP00000229214	0.718	KRR1 small subunit processome component homolog
17	9606.ENSP00000371634	0.710	Insulin-like growth factor 2 mRNA-binding protein 2
18	9606.ENSP00000219746	0.709	TOX high mobility group box family member 3
19	9606.ENSP00000278520	0.706	Coiled-coil domain containing 82
20	9606.ENSP00000242257	0.700	rRNA methyltransferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030234	1.000	enzyme regulator activity
GO:0005515	1.000	protein binding
GO:0097159	0.329	organic cyclic compound binding
GO:1901363	0.318	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0009451	0.966	RNA modification
GO:0001510	0.955	RNA methylation
GO:0006400	0.955	tRNA modification
GO:0030488	0.884	tRNA methylation
GO:0065007	0.697	biological regulation
GO:0050794	0.642	regulation of cellular process
GO:0048878	0.448	chemical homeostasis
GO:0055074	0.381	calcium ion homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0032991	0.780	protein-containing complex
GO:0005829	0.700	cytosol
GO:0043232	0.445	intracellular non-membrane-bounded organelle
GO:0016020	0.395	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]