StarFunc result for job id Q6YI46

User Input

>input (380 residues)
MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAA
ASGALLGAYLERHGPPEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWC
RSLVLVCVLAALCFASLALVRRYLHHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIV
LNVAAGYLYGFVLGMGLMMVGVLIGTFIAHVVCKRLLTAWVAARIQSSEKLSAVIRVVEG
GSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTTLRTME
DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTS
GSSFYNKRTLTFSGGGINVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U145	0.559	0.558	1.376E-37	381	0.895	0.892	Q3U145.pdb.gz	TMM64_MOUSE Transmembrane protein 64 OS=Mus musculus OX=10090 GN=Tmem64 PE=1 SV=1
2	AFDB:Q9LPD5	0.459	0.634	3.736E-8	261	0.142	0.207	Q9LPD5.pdb.gz	Q9LPD5_ARATH SNARE associated Golgi protein family OS=Arabidopsis thaliana OX=3702 GN=At1g44960 PE=1 SV=1
3	AFDB:O23137	0.432	0.468	1.960E-7	344	0.137	0.151	O23137.pdb.gz	O23137_ARATH At1g22850/F29G20_19 OS=Arabidopsis thaliana OX=3702 GN=F29G20.19 PE=1 SV=1
4	AFDB:P76219	0.439	0.681	2.484E-7	236	0.121	0.195	P76219.pdb.gz	YDJX_ECOLI TVP38/TMEM64 family membrane protein YdjX OS=Escherichia coli (strain K12) OX=83333 GN=ydjX PE=3 SV=2
5	AFDB:Q9P781	0.396	0.535	7.042E-7	276	0.121	0.167	Q9P781.pdb.gz	TVP38_SCHPO Golgi apparatus membrane protein tvp38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tvp38 PE=3 SV=2
6	AFDB:P36164	0.472	0.524	1.131E-6	337	0.150	0.169	P36164.pdb.gz	TVP38_YEAST Golgi apparatus membrane protein TVP38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TVP38 PE=1 SV=1
7	AFDB:Q9SZ65	0.440	0.535	4.465E-6	306	0.137	0.170	Q9SZ65.pdb.gz	Q9SZ65_ARATH SNARE associated Golgi protein family OS=Arabidopsis thaliana OX=3702 GN=At4g12000 PE=1 SV=1
8	AFDB:Q7M6Z4	0.154	0.047	1.569E-1	1394	0.145	0.039	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
9	AFDB:Q8K1N2	0.088	0.033	4.663E-1	1249	0.166	0.050	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
10	AFDB:Q10165	0.163	0.080	5.374E-1	923	0.095	0.039	Q10165.pdb.gz	CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnt6 PE=1 SV=1
11	PDB:6ob6B	0.113	0.118	7.052E-1	357	0.076	0.081	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
12	PDB:7bc7A	0.109	0.100	1.505	432	0.074	0.065	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
13	PDB:6jmqA	0.110	0.106	1.578	403	0.126	0.119	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
14	PDB:5oxpA	0.128	0.113	1.654	462	0.113	0.093	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
15	PDB:6awlA	0.122	0.190	2.096	217	0.068	0.120	6awlA.pdb.gz
16	PDB:5abbA	0.098	0.087	2.533	443	0.097	0.084	5abbA.pdb.gz
17	PDB:7yr5A	0.113	0.111	2.656	385	0.066	0.065	7yr5A.pdb.gz
18	PDB:6o7va	0.110	0.072	3.210	625	0.076	0.046	6o7va.pdb.gz
19	PDB:7aqsE	0.115	0.244	3.366	159	0.032	0.075	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
20	PDB:7qj2G	0.152	0.098	3.529	640	0.042	0.025	7qj2G.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U145	0.0	573	381	0.868	0.866	TMM64_MOUSE Transmembrane protein 64 OS=Mus musculus OX=10090 GN=Tmem64 PE=1 SV=1
2	Q9SZ65	5.98e-07	53.1	306	0.126	0.157	Q9SZ65_ARATH SNARE associated Golgi protein family OS=Arabidopsis thaliana OX=3702 GN=At4g12000 PE=1 SV=1
3	O23137	1.70e-05	48.5	344	0.071	0.078	O23137_ARATH At1g22850/F29G20_19 OS=Arabidopsis thaliana OX=3702 GN=F29G20.19 PE=1 SV=1
4	P36164	7.37e-05	46.6	337	0.121	0.136	TVP38_YEAST Golgi apparatus membrane protein TVP38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TVP38 PE=1 SV=1
5	Q04671	0.17	36.6	838	0.061	0.027	P_HUMAN P protein OS=Homo sapiens OX=9606 GN=OCA2 PE=1 SV=2
6	A0A8I6A5E1	0.64	34.7	1247	0.082	0.025	A0A8I6A5E1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
7	A0A8I6AGR8	0.64	34.7	1216	0.082	0.025	A0A8I6AGR8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
8	Q9UQ49	0.82	34.3	428	0.058	0.051	NEUR3_HUMAN Sialidase-3 OS=Homo sapiens OX=9606 GN=NEU3 PE=1 SV=1
9	Q9LPD5	1.0	33.5	261	0.058	0.084	Q9LPD5_ARATH SNARE associated Golgi protein family OS=Arabidopsis thaliana OX=3702 GN=At1g44960 PE=1 SV=1
10	Q8IN94	1.2	33.9	2716	0.068	0.010	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
11	Q6PDG5	1.4	33.5	1213	0.082	0.026	SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus OX=10090 GN=Smarcc2 PE=1 SV=2
12	F8VXC8	1.9	33.1	1245	0.076	0.023	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
13	Q8TAQ2	1.9	33.1	1214	0.076	0.024	SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
14	Q9QXY2	6.4	31.6	1197	0.053	0.017	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
15	F4I1T7	7.6	31.2	1819	0.061	0.013	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
16	Q9M898	8.8	30.8	348	0.053	0.057	Q9M898_ARATH AT3g02420/F16B3_5 OS=Arabidopsis thaliana OX=3702 GN=At3g02420 PE=1 SV=1
17	Q6PAC4	9.6	30.8	1279	0.050	0.015	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09335 SNARE_assoc	5e-13	60.9	SNARE associated Golgi protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374447	0.718	Leucine-rich repeat and calponin homology domain-containing protein 1
2	9606.ENSP00000377280	0.672	F-box only protein 8
3	9606.ENSP00000312649	0.667	Peroxisome proliferator-activated receptor gamma coactivator 1-beta
4	9606.ENSP00000318177	0.643	Far upstream element-binding protein 3
5	9606.ENSP00000380746	0.609	F-box/LRR-repeat protein 16
6	9606.ENSP00000297350	0.576	Tumor necrosis factor receptor superfamily member 11B
7	9606.ENSP00000261667	0.549	Importin subunit alpha-4
8	9606.ENSP00000415491	0.539	Phytanoyl-CoA hydroxylase-interacting protein
9	9606.ENSP00000406885	0.533	Transmembrane protein 41A
10	9606.ENSP00000332706	0.518	Transcriptional activator protein Pur-alpha
11	9606.ENSP00000368908	0.508	LHFPL tetraspan subfamily member 6 protein
12	9606.ENSP00000440045	0.508	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.941	positive regulation of biological process
GO:0048523	0.852	negative regulation of cellular process
GO:0048522	0.799	positive regulation of cellular process
GO:0032502	0.719	developmental process
GO:0048856	0.697	anatomical structure development
GO:0048878	0.471	chemical homeostasis
GO:0050801	0.460	monoatomic ion homeostasis
GO:0098771	0.451	inorganic ion homeostasis
GO:0051239	0.437	regulation of multicellular organismal process
GO:0065009	0.378	regulation of molecular function
GO:0002682	0.371	regulation of immune system process
GO:0043462	0.364	regulation of ATP-dependent activity
GO:0045595	0.357	regulation of cell differentiation
GO:0055080	0.355	monoatomic cation homeostasis
GO:2000026	0.352	regulation of multicellular organismal development
GO:0002684	0.348	positive regulation of immune system process
GO:0060828	0.345	regulation of canonical Wnt signaling pathway
GO:1902107	0.344	positive regulation of leukocyte differentiation
GO:0090090	0.336	negative regulation of canonical Wnt signaling pathway
GO:0006873	0.335	intracellular monoatomic ion homeostasis
GO:0030003	0.332	intracellular monoatomic cation homeostasis
GO:0002763	0.326	positive regulation of myeloid leukocyte differentiation
GO:0051093	0.321	negative regulation of developmental process
GO:0030097	0.319	hemopoiesis
GO:0030099	0.309	myeloid cell differentiation
GO:0045596	0.308	negative regulation of cell differentiation
GO:0055074	0.307	calcium ion homeostasis
GO:0006874	0.304	intracellular calcium ion homeostasis
GO:0002521	0.302	leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005783	0.993	endoplasmic reticulum
GO:0016020	0.764	membrane
GO:0070013	0.705	intracellular organelle lumen
GO:0031981	0.507	nuclear lumen
GO:0005654	0.350	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]