StarFunc result for job id Q6YP21

User Input

>input (454 residues)
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6YP21	1.000	1.000	1.193E-88	454	1.000	1.000	Q6YP21.pdb.gz	KAT3_HUMAN Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens OX=9606 GN=KYAT3 PE=1 SV=1
2	AFDB:Q71RI9	0.953	0.951	8.854E-79	455	0.837	0.835	Q71RI9.pdb.gz	KAT3_MOUSE Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus OX=10090 GN=Kyat3 PE=1 SV=1
3	PDB:3e2yA	0.897	0.993	3.385E-71	410	0.771	0.854	3e2yA.pdb.gz	Correction for Han et al., "Biochemical and Structural Properties of Mouse Kynurenine Aminotransferase III".
4	AFDB:Q17CS8	0.907	0.864	2.730E-60	477	0.526	0.501	Q17CS8.pdb.gz	KAT_AEDAE Kynurenine aminotransferase OS=Aedes aegypti OX=7159 GN=KAT PE=1 SV=1
5	AFDB:Q16773	0.889	0.955	1.478E-58	422	0.474	0.509	Q16773.pdb.gz	KAT1_HUMAN Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens OX=9606 GN=KYAT1 PE=1 SV=1
6	AFDB:Q8BTY1	0.883	0.945	1.516E-57	424	0.467	0.500	Q8BTY1.pdb.gz	KAT1_MOUSE Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus OX=10090 GN=Kyat1 PE=1 SV=1
7	PDB:2r5cB	0.886	0.960	4.583E-57	419	0.511	0.554	2r5cB.pdb.gz	Structural insight into the mechanism of substrate specificity of aedes kynurenine aminotransferase.
8	AFDB:Q08415	0.876	0.939	8.934E-57	423	0.458	0.492	Q08415.pdb.gz	KAT1_RAT Kynurenine--oxoglutarate transaminase 1 OS=Rattus norvegicus OX=10116 GN=Kyat1 PE=1 SV=2
9	PDB:3fvsA	0.875	0.947	6.557E-56	419	0.476	0.516	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
10	AFDB:Q389E5	0.841	0.888	6.246E-45	429	0.333	0.352	Q389E5.pdb.gz	Q389E5_TRYB2 Kynurenine aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1810 PE=4 SV=1
11	AFDB:Q9CAP1	0.814	0.840	7.998E-44	440	0.348	0.359	Q9CAP1.pdb.gz	Q9CAP1_ARATH At1g77670 OS=Arabidopsis thaliana OX=3702 GN=At1g77670 PE=1 SV=1
12	AFDB:O14209	0.845	0.910	2.226E-42	421	0.306	0.330	O14209.pdb.gz	YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6B12.04c PE=3 SV=1
13	AFDB:P47039	0.848	0.866	5.403E-42	444	0.306	0.313	P47039.pdb.gz	BNA3_YEAST Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA3 PE=1 SV=1
14	PDB:3b46B	0.823	0.877	1.979E-40	425	0.297	0.318	3b46B.pdb.gz
15	PDB:2o0rA	0.804	0.944	4.068E-40	385	0.317	0.374	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
16	PDB:1u08A	0.779	0.920	1.450E-37	382	0.278	0.330	1u08A.pdb.gz	Crystal structure and reactivity of YbdL from Escherichia coli identify a methionine aminotransferase function
17	PDB:5wmlA	0.769	0.860	2.358E-31	404	0.251	0.282	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
18	PDB:5yhvA	0.717	0.820	1.207E-29	394	0.209	0.241	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
19	PDB:6l1lB	0.708	0.813	1.076E-27	393	0.203	0.234	6l1lB.pdb.gz	Structural insights into the catalytic mechanism of Bacillus subtilis BacF.
20	PDB:4cvqA	0.727	0.811	4.175E-26	404	0.192	0.215	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6YP21	0.0	939	454	1.000	1.000	KAT3_HUMAN Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens OX=9606 GN=KYAT3 PE=1 SV=1
2	Q71RI9	0.0	801	455	0.837	0.835	KAT3_MOUSE Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus OX=10090 GN=Kyat3 PE=1 SV=1
3	Q16773	3.52e-167	479	422	0.474	0.509	KAT1_HUMAN Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens OX=9606 GN=KYAT1 PE=1 SV=1
4	Q8BTY1	3.68e-163	468	424	0.467	0.500	KAT1_MOUSE Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus OX=10090 GN=Kyat1 PE=1 SV=1
5	Q17CS8	6.06e-163	470	477	0.513	0.488	KAT_AEDAE Kynurenine aminotransferase OS=Aedes aegypti OX=7159 GN=KAT PE=1 SV=1
6	Q08415	1.88e-159	459	423	0.458	0.492	KAT1_RAT Kynurenine--oxoglutarate transaminase 1 OS=Rattus norvegicus OX=10116 GN=Kyat1 PE=1 SV=2
7	Q389E5	4.39e-88	277	429	0.333	0.352	Q389E5_TRYB2 Kynurenine aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1810 PE=4 SV=1
8	Q9CAP1	1.11e-87	276	440	0.344	0.355	Q9CAP1_ARATH At1g77670 OS=Arabidopsis thaliana OX=3702 GN=At1g77670 PE=1 SV=1
9	O14209	9.03e-75	242	421	0.313	0.337	YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6B12.04c PE=3 SV=1
10	P47039	1.19e-71	234	444	0.289	0.295	BNA3_YEAST Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA3 PE=1 SV=1
11	P9WPZ5	2.56e-71	232	397	0.328	0.375	DAPC_MYCTU Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dapC PE=1 SV=1
12	P77806	3.15e-67	221	386	0.297	0.350	YBDL_ECOLI Methionine aminotransferase OS=Escherichia coli (strain K12) OX=83333 GN=ybdL PE=1 SV=1
13	Q9HUI9	1.04e-47	170	393	0.229	0.265	ARUH_PSEAE Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aruH PE=1 SV=1
14	E9L7A5	1.71e-46	169	479	0.280	0.265	PAT_PETHY Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida OX=4102 GN=PPA-AT PE=1 SV=1
15	Q9SIE1	1.39e-44	164	475	0.244	0.234	PAT_ARATH Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=PAT PE=1 SV=2
16	Q8DTM1	1.00e-38	146	393	0.207	0.239	NOAT_STRMU Asparagine--oxo-acid transaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aspB PE=1 SV=1
17	P77434	4.33e-29	120	412	0.236	0.260	ALAC_ECOLI Glutamate-pyruvate aminotransferase AlaC OS=Escherichia coli (strain K12) OX=83333 GN=alaC PE=1 SV=1
18	P96847	3.02e-26	111	388	0.209	0.245	AVTA_MYCTU Valine--pyruvate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aspB PE=1 SV=2
19	Q9VY42	3.14e-23	104	501	0.194	0.176	Q9VY42_DROME Tyrosine aminotransferase OS=Drosophila melanogaster OX=7227 GN=Tat PE=2 SV=1
20	Q58786	3.24e-21	97.4	418	0.200	0.218	DAPAT_METJA LL-diaminopimelate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=dapL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	1.7e-49	180.6	Aminotransferase class I and II
2	PF01053 Cys_Met_Meta_PP	4.4	17.4	Cys/Met metabolism PLP-dependent enzyme
3	PF01041 DegT_DnrJ_EryC1	73	14.0	DegT/DnrJ/EryC1/StrS aminotransferase family
4	PF05295 Luciferase_N	3.6e+02	12.6	Luciferase/LBP N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355517	0.981	Kynurenine 3-monooxygenase
2	9606.ENSP00000264170	0.978	Kynureninase
3	9606.ENSP00000245206	0.971	Aspartate aminotransferase, mitochondrial
4	9606.ENSP00000328938	0.959	Kynurenine formamidase
5	9606.ENSP00000359976	0.953	Cystathionine gamma-lyase
6	9606.ENSP00000359539	0.940	Aspartate aminotransferase, cytoplasmic
7	9606.ENSP00000255192	0.923	S-methylmethionine--homocysteine S-methyltransferase BHMT2
8	9606.ENSP00000434516	0.920	Thioredoxin reductase 1, cytoplasmic
9	9606.ENSP00000217426	0.917	Adenosylhomocysteinase
10	9606.ENSP00000383365	0.917	Thioredoxin reductase 2, mitochondrial
11	9606.ENSP00000250535	0.913	Cysteine dioxygenase type 1
12	9606.ENSP00000380402	0.913	3-mercaptopyruvate sulfurtransferase
13	9606.ENSP00000385828	0.913	Thiosulfate sulfurtransferase
14	9606.ENSP00000303077	0.912	Putative aspartate aminotransferase, cytoplasmic 2
15	9606.ENSP00000355536	0.911	Methionine synthase
16	9606.ENSP00000315931	0.909	Adenosylhomocysteinase 3
17	9606.ENSP00000358814	0.909	S-adenosylhomocysteine hydrolase-like protein 1
18	9606.ENSP00000274353	0.906	Betaine--homocysteine S-methyltransferase 1
19	9606.ENSP00000423190	0.901	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
20	9606.ENSP00000275428	0.870	Gamma-glutamylcyclotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	1.000	transaminase activity
GO:0005515	0.995	protein binding
GO:0003723	0.995	RNA binding
GO:0042802	0.910	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:1901360	0.992	organic cyclic compound metabolic process
GO:0006725	0.990	cellular aromatic compound metabolic process
GO:1901605	0.981	alpha-amino acid metabolic process
GO:0042537	0.968	benzene-containing compound metabolic process
GO:0042180	0.960	cellular ketone metabolic process
GO:0009058	0.557	biosynthetic process
GO:0043648	0.480	dicarboxylic acid metabolic process
GO:0044282	0.392	small molecule catabolic process
GO:0046395	0.338	carboxylic acid catabolic process
GO:1901576	0.310	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.988	mitochondrion
GO:0005829	0.972	cytosol
GO:0070013	0.596	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	1.000	Transaminases.

[back to server]