StarFunc result for job id Q6ZMB0

User Input

>input (384 residues)
MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEP
PSELVPGPPCVANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLL
LAVKSAPEHYERRELIRRTWGQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAR
EHGDVLQWAFADTFLNLTLKHLHLLDWLAARCPHARFLLSGDDDVFVHTANVVRFLQAQP
PGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSGPTARALRAAAR
HTPLFPIDDAYMGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP
YEMLLMWKALHSPALSCDRGHRVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMB0	1.000	1.000	1.017E-83	384	1.000	1.000	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
2	AFDB:Q9Y2A9	0.798	0.823	1.023E-47	372	0.490	0.505	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
3	AFDB:Q8NFL0	0.775	0.743	1.872E-41	401	0.385	0.369	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
4	AFDB:Q8K0J2	0.774	0.749	4.356E-41	397	0.396	0.383	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
5	AFDB:Q9C0J1	0.749	0.761	8.810E-39	378	0.404	0.410	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	AFDB:Q9Z222	0.745	0.722	1.911E-37	397	0.362	0.350	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	PDB:7jhiC	0.740	0.855	3.463E-36	331	0.320	0.372	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
8	AFDB:Q9NY97	0.746	0.722	4.105E-35	397	0.344	0.332	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
9	AFDB:Q7Z7M8	0.715	0.692	5.838E-34	397	0.344	0.332	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
10	AFDB:O43825	0.641	0.585	6.725E-30	422	0.297	0.270	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
11	AFDB:O54904	0.638	0.748	1.306E-29	326	0.245	0.288	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
12	PDB:4fixA	0.316	0.207	5.310E-6	629	0.083	0.051	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
13	PDB:4y63A	0.302	0.391	1.313E-5	282	0.086	0.117	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:6fxrA	0.308	0.186	1.775E-5	700	0.078	0.043	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
15	PDB:1ll0B	0.274	0.366	2.237E-4	267	0.078	0.112	1ll0B.pdb.gz
16	PDB:4hg6A	0.353	0.195	3.213E-4	747	0.115	0.059	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
17	PDB:1i52A	0.258	0.385	1.452E-3	225	0.089	0.151	1i52A.pdb.gz	Structure of 4-diphosphocytidyl-2-C- methylerythritol synthetase involved in mevalonate- independent isoprenoid biosynthesis.
18	PDB:7d72A	0.235	0.224	1.452E-3	407	0.081	0.076	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:7x8kB	0.255	0.264	1.542E-3	367	0.081	0.084	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
20	PDB:5vcmB	0.274	0.290	2.215E-3	358	0.096	0.103	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZMB0	0.0	777	384	1.000	1.000	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
2	Q9Y2A9	1.34e-118	350	372	0.458	0.473	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
3	Q8NFL0	3.00e-90	279	401	0.375	0.359	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
4	Q8K0J2	2.28e-89	276	397	0.370	0.358	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
5	Q9C0J1	6.24e-84	262	378	0.354	0.360	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	Q9Z222	7.93e-84	262	397	0.333	0.322	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
7	Q9NY97	7.78e-79	249	397	0.320	0.310	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
8	Q9BYG0	1.16e-53	184	378	0.260	0.265	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
9	Q99NB2	7.71e-51	176	377	0.253	0.257	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
10	Q8BGY6	1.57e-49	173	376	0.242	0.247	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
11	O43825	1.44e-47	169	422	0.268	0.244	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	Q7Z7M8	7.91e-47	166	397	0.312	0.302	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
13	O54904	8.02e-47	164	326	0.224	0.264	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
14	Q9Y5Z6	8.02e-47	164	326	0.224	0.264	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
15	O54905	2.66e-46	165	422	0.271	0.246	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
16	Q9Y2C3	6.41e-44	156	310	0.211	0.261	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
17	Q9JI67	1.46e-42	152	308	0.201	0.250	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
18	Q24157	2.70e-39	144	325	0.242	0.286	BRN_DROME Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2
19	Q920V1	4.17e-35	133	331	0.193	0.224	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
20	O75752	7.83e-35	132	331	0.221	0.257	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	4.7e+02	11.6	Fringe-like
2	PF01762 Galactosyl_T	5.5e-40	148.8	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379377	0.973	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
2	9606.ENSP00000389176	0.973	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
3	9606.ENSP00000415454	0.968	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
4	9606.ENSP00000304364	0.967	C1GALT1-specific chaperone 1
5	9606.ENSP00000156626	0.961	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
6	9606.ENSP00000484824	0.938	Mucin-1
7	9606.ENSP00000406861	0.932	Mucin-6
8	9606.ENSP00000414350	0.932	Mucin-20
9	9606.ENSP00000407422	0.931	Mucin-7
10	9606.ENSP00000417498	0.931	Mucin-4
11	9606.ENSP00000302716	0.926	Mucin-17
12	9606.ENSP00000381008	0.926	Mucin-16
13	9606.ENSP00000485659	0.924	Mucin-5AC
14	9606.ENSP00000436812	0.923	Mucin-5B
15	9606.ENSP00000365473	0.919	Mucin-21
16	9606.ENSP00000485028	0.919	Mucin-13
17	9606.ENSP00000441929	0.916	Mucin-12
18	9606.ENSP00000368771	0.913	Mucin-3A
19	9606.ENSP00000416753	0.911	Mucin-15
20	9606.ENSP00000311364	0.900	Mucin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008499	1.000	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0008375	0.742	acetylglucosaminyltransferase activity
GO:0005488	0.710	binding
GO:0005515	0.675	protein binding
GO:0140096	0.378	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006493	0.995	protein O-linked glycosylation
GO:0016266	0.370	O-glycan processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0071944	0.688	cell periphery
GO:0005886	0.683	plasma membrane
GO:1903561	0.578	extracellular vesicle
GO:0070062	0.397	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]