StarFunc result for job id Q6ZMJ4

User Input

>input (242 residues)
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPI
NYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ
EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCC
KQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL
LP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMJ4	1.000	1.000	4.916E-36	242	1.000	1.000	Q6ZMJ4.pdb.gz	IL34_HUMAN Interleukin-34 OS=Homo sapiens OX=9606 GN=IL34 PE=1 SV=1
2	AFDB:Q8R1R4	0.702	0.723	4.694E-24	235	0.678	0.698	Q8R1R4.pdb.gz	IL34_MOUSE Interleukin-34 OS=Mus musculus OX=10090 GN=Il34 PE=1 SV=1
3	AFDB:R4GIU3	0.598	0.802	5.039E-13	178	0.298	0.404	R4GIU3.pdb.gz	R4GIU3_CHICK Interleukin 34 OS=Gallus gallus OX=9031 GN=IL34 PE=2 SV=1
4	AFDB:B3DLJ8	0.580	0.655	6.801E-11	213	0.248	0.282	B3DLJ8.pdb.gz	B3DLJ8_DANRE Interleukin 34 OS=Danio rerio OX=7955 GN=si:ch211-239j19.3 PE=2 SV=1
5	AFDB:P40225	0.392	0.284	3.300E-4	353	0.153	0.105	P40225.pdb.gz	TPO_HUMAN Thrombopoietin OS=Homo sapiens OX=9606 GN=THPO PE=1 SV=1
6	AFDB:P49745	0.390	0.305	3.465E-4	326	0.157	0.117	P49745.pdb.gz	TPO_RAT Thrombopoietin OS=Rattus norvegicus OX=10116 GN=Thpo PE=2 SV=1
7	AFDB:P40226	0.399	0.290	1.167E-3	356	0.182	0.124	P40226.pdb.gz	TPO_MOUSE Thrombopoietin OS=Mus musculus OX=10090 GN=Thpo PE=2 SV=1
8	AFDB:P01588	0.384	0.456	4.124E-3	193	0.124	0.155	P01588.pdb.gz	EPO_HUMAN Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1
9	AFDB:Q8JZQ0	0.335	0.170	6.385E-3	566	0.136	0.058	Q8JZQ0.pdb.gz	CSF1_RAT Macrophage colony-stimulating factor 1 OS=Rattus norvegicus OX=10116 GN=Csf1 PE=1 SV=1
10	AFDB:P09603	0.334	0.172	8.140E-3	554	0.140	0.061	P09603.pdb.gz	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2
11	PDB:1huwA	0.310	0.413	8.023E-2	166	0.099	0.145	1huwA.pdb.gz
12	PDB:7zxkC	0.294	0.388	5.597E-1	166	0.107	0.157	7zxkC.pdb.gz
13	PDB:7bc7A	0.233	0.143	5.876E-1	432	0.083	0.046	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
14	PDB:1rw5A	0.320	0.370	6.475E-1	199	0.083	0.101	1rw5A.pdb.gz
15	PDB:1bp3A	0.275	0.339	7.136E-1	186	0.091	0.118	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
16	PDB:1f6fA	0.358	0.450	7.136E-1	183	0.107	0.142	1f6fA.pdb.gz
17	PDB:1cnt2	0.214	0.349	7.491E-1	130	0.116	0.215	1cnt2.pdb.gz
18	PDB:4cniC	0.272	0.358	9.549E-1	171	0.087	0.123	4cniC.pdb.gz
19	PDB:7z0lB	0.296	0.209	9.549E-1	370	0.103	0.068	7z0lB.pdb.gz
20	PDB:7u7nD	0.309	0.360	1.105	191	0.124	0.157	7u7nD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZMJ4	1.26e-178	491	242	1.000	1.000	IL34_HUMAN Interleukin-34 OS=Homo sapiens OX=9606 GN=IL34 PE=1 SV=1
2	Q8R1R4	4.53e-114	328	235	0.657	0.677	IL34_MOUSE Interleukin-34 OS=Mus musculus OX=10090 GN=Il34 PE=1 SV=1
3	R4GIU3	1.47e-34	124	178	0.285	0.388	R4GIU3_CHICK Interleukin 34 OS=Gallus gallus OX=9031 GN=IL34 PE=2 SV=1
4	B3DLJ8	2.14e-17	80.1	213	0.240	0.272	B3DLJ8_DANRE Interleukin 34 OS=Danio rerio OX=7955 GN=si:ch211-239j19.3 PE=2 SV=1
5	F4KC57	0.033	37.0	243	0.083	0.082	F4KC57_ARATH SNF7 family protein OS=Arabidopsis thaliana OX=3702 GN=VPS201 PE=1 SV=1
6	Q8GXN6	0.30	33.9	219	0.066	0.073	VP201_ARATH Vacuolar protein sorting-associated protein 20 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS20.1 PE=1 SV=1
7	Q9FY89	0.57	33.1	216	0.066	0.074	VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS20.2 PE=1 SV=1
8	D4A678	1.7	32.3	2415	0.070	0.007	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
9	Q6XDA1	1.7	32.3	2385	0.070	0.007	Q6XDA1_RAT Erythroid spectrin alpha OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
10	A0A8J8Y4Y9	1.9	32.3	2339	0.070	0.007	A0A8J8Y4Y9_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
11	Q681I0	2.3	32.0	465	0.120	0.062	ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=ORTHL PE=2 SV=1
12	Q93VM9	2.8	31.6	599	0.041	0.017	THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=THO1 PE=1 SV=1
13	Q8BG99	4.9	30.8	474	0.066	0.034	PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus OX=10090 GN=Pknox2 PE=2 SV=1
14	Q96KN3	5.0	30.8	472	0.066	0.034	PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens OX=9606 GN=PKNOX2 PE=1 SV=2
15	O61267	5.9	30.4	476	0.074	0.038	LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster OX=7227 GN=lok PE=2 SV=1
16	Q1ZXQ8	6.4	30.8	2013	0.116	0.014	MTAA_DICDI Centrosomal protein 224 OS=Dictyostelium discoideum OX=44689 GN=mtaA PE=1 SV=1
17	Q6T3S5	6.6	30.4	924	0.058	0.015	Q6T3S5_DROME AMO OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=1
18	Q9VK95	6.6	30.4	924	0.058	0.015	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
19	P18616	8.4	30.4	1839	0.054	0.007	NRPB1_ARATH DNA-directed RNA polymerase II subunit RPB1 OS=Arabidopsis thaliana OX=3702 GN=NRPB1 PE=1 SV=3
20	Q55GN6	9.9	30.0	719	0.079	0.026	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15036 IL34	1.7e-72	254.2	Interleukin 34

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286301	0.999	Macrophage colony-stimulating factor 1 receptor
2	9606.ENSP00000377047	0.995	Receptor-type tyrosine-protein phosphatase zeta
3	9606.ENSP00000327513	0.979	Macrophage colony-stimulating factor 1
4	9606.ENSP00000370542	0.922	Syndecan-1
5	9606.ENSP00000381775	0.800	Tumor necrosis factor ligand superfamily member 11
6	9606.ENSP00000351059	0.618	CX3C chemokine receptor 1
7	9606.ENSP00000341170	0.579	Pleiotrophin
8	9606.ENSP00000301904	0.574	Scavenger receptor class A member 3
9	9606.ENSP00000376553	0.562	Transmembrane protein 119
10	9606.ENSP00000227163	0.558	Transcription factor PU.1
11	9606.ENSP00000362205	0.547	Triggering receptor expressed on myeloid cells 2
12	9606.ENSP00000412237	0.541	Interleukin-10
13	9606.ENSP00000241453	0.533	Receptor-type tyrosine-protein kinase FLT3
14	9606.ENSP00000307259	0.521	P2Y purinoceptor 12
15	9606.ENSP00000268638	0.518	Interferon regulatory factor 8
16	9606.ENSP00000296871	0.505	Granulocyte-macrophage colony-stimulating factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005126	1.000	cytokine receptor binding
GO:0005157	0.982	macrophage colony-stimulating factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048584	0.990	positive regulation of response to stimulus
GO:0051716	0.989	cellular response to stimulus
GO:0023052	0.986	signaling
GO:0007154	0.986	cell communication
GO:0050794	0.985	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0001934	0.978	positive regulation of protein phosphorylation
GO:0030335	0.977	positive regulation of cell migration
GO:0002685	0.975	regulation of leukocyte migration
GO:0032101	0.973	regulation of response to external stimulus
GO:2000026	0.966	regulation of multicellular organismal development
GO:0009966	0.966	regulation of signal transduction
GO:0002687	0.966	positive regulation of leukocyte migration
GO:0045595	0.965	regulation of cell differentiation
GO:0051347	0.965	positive regulation of transferase activity
GO:0032103	0.964	positive regulation of response to external stimulus
GO:0051240	0.960	positive regulation of multicellular organismal process
GO:0009967	0.957	positive regulation of signal transduction
GO:0010720	0.955	positive regulation of cell development
GO:0043408	0.953	regulation of MAPK cascade
GO:0007165	0.947	signal transduction
GO:0042221	0.941	response to chemical
GO:0008284	0.941	positive regulation of cell population proliferation
GO:0050730	0.933	regulation of peptidyl-tyrosine phosphorylation
GO:0033674	0.931	positive regulation of kinase activity
GO:0050920	0.917	regulation of chemotaxis
GO:0007166	0.908	cell surface receptor signaling pathway
GO:0002688	0.906	regulation of leukocyte chemotaxis
GO:0045859	0.905	regulation of protein kinase activity
GO:1902533	0.900	positive regulation of intracellular signal transduction
GO:0010468	0.884	regulation of gene expression
GO:0010033	0.883	response to organic substance
GO:1902107	0.878	positive regulation of leukocyte differentiation
GO:0050921	0.877	positive regulation of chemotaxis
GO:0045860	0.871	positive regulation of protein kinase activity
GO:0002690	0.869	positive regulation of leukocyte chemotaxis
GO:0050731	0.860	positive regulation of peptidyl-tyrosine phosphorylation
GO:1905521	0.851	regulation of macrophage migration
GO:0043410	0.828	positive regulation of MAPK cascade
GO:0071345	0.814	cellular response to cytokine stimulus
GO:0032502	0.811	developmental process
GO:0019221	0.795	cytokine-mediated signaling pathway
GO:0045637	0.793	regulation of myeloid cell differentiation
GO:0002763	0.781	positive regulation of myeloid leukocyte differentiation
GO:0048856	0.750	anatomical structure development
GO:0071900	0.723	regulation of protein serine/threonine kinase activity
GO:0070663	0.695	regulation of leukocyte proliferation
GO:0010628	0.678	positive regulation of gene expression
GO:0071675	0.609	regulation of mononuclear cell migration
GO:0043405	0.578	regulation of MAP kinase activity
GO:0032501	0.573	multicellular organismal process
GO:0071622	0.570	regulation of granulocyte chemotaxis
GO:0061097	0.537	regulation of protein tyrosine kinase activity
GO:0071902	0.512	positive regulation of protein serine/threonine kinase activity
GO:0070665	0.469	positive regulation of leukocyte proliferation
GO:0030154	0.458	cell differentiation
GO:0048519	0.379	negative regulation of biological process
GO:0001817	0.358	regulation of cytokine production
GO:0007275	0.354	multicellular organism development
GO:0043406	0.319	positive regulation of MAP kinase activity
GO:0061098	0.301	positive regulation of protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005886	0.463	plasma membrane
GO:0043231	0.366	intracellular membrane-bounded organelle
GO:0005737	0.309	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]