StarFunc result for job id Q6ZMN7

User Input

>input (1036 residues)
MGFALERFAEAVDPALECKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRRCPLQCQPLA
PGELYRVLPLRSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRGGCAS
GLGGGEVPARGGCGPTPRAGRGGGARGGPPGGRWGRGRGPGPRVLAWRRREKALLAQLWA
LQGEVQLTARRYQEKFTQYMAHVRNFVGDLGGGHRRDGEHKPFTIVLERENDTLGFNIIG
GRPNQNNQEGTSTEGIYVSKILENGPADRADGLEIHDKIMEVNGKDLSKATHEEAVEAFR
NAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDIC
PFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCY
RTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECKRIV
LLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTD
TATSSSNNHEKDSGVGRTDESLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVEL
QYNESLVSGEYIDSDCIGNPDEDCERFRQLLELKCKIRNHGEYDLYYSSSTIECNQGEQE
GVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIWTLHDGGFRNYNTSIDMQRGK
LDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQ
SSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRY
ANIPAHARHYQSYMQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRY
ITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRR
EFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKS
PDGTRVHNAFLSVTTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMN7	1.000	1.000	0.000	1036	1.000	1.000	Q6ZMN7.pdb.gz	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
2	AFDB:O54824	0.130	0.105	5.055E-15	1322	0.139	0.109	O54824.pdb.gz	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
3	AFDB:Q14005	0.094	0.075	1.675E-13	1332	0.125	0.097	Q14005.pdb.gz	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
4	AFDB:Q9NB04	0.087	0.102	5.278E-13	871	0.104	0.124	Q9NB04.pdb.gz	PATJ_DROME Patj homolog OS=Drosophila melanogaster OX=7227 GN=Patj PE=1 SV=2
5	AFDB:Q9EQJ9	0.106	0.079	8.353E-13	1476	0.106	0.075	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
6	AFDB:Q17353	0.108	0.085	7.831E-12	1379	0.120	0.090	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
7	PDB:2xkxA	0.088	0.123	1.259E-10	721	0.065	0.093	2xkxA.pdb.gz
8	AFDB:G5ECZ8	0.094	0.047	1.380E-10	2422	0.111	0.047	G5ECZ8.pdb.gz	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
9	AFDB:E9Q9R9	0.109	0.066	9.644E-9	1921	0.120	0.065	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
10	PDB:7p73A	0.084	0.201	1.091E-6	420	0.038	0.093	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	PDB:7pc3A	0.079	0.197	1.937E-6	405	0.034	0.086	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	AFDB:Q8WXI2	0.078	0.078	5.318E-6	1034	0.112	0.112	Q8WXI2.pdb.gz	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
13	AFDB:Q9VT49	0.083	0.114	5.965E-6	730	0.095	0.134	Q9VT49.pdb.gz	Q9VT49_DROME Z band alternatively spliced PDZ-motif protein 67, isoform G OS=Drosophila melanogaster OX=7227 GN=Zasp67 PE=4 SV=2
14	PDB:5n7dA	0.082	0.193	2.157E-5	423	0.024	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:6t36A	0.079	0.783	2.420E-5	93	0.026	0.290	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7p70A	0.075	0.185	3.616E-5	407	0.031	0.079	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:5dkaA	0.073	0.609	4.056E-5	96	0.026	0.281	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:7pcbA	0.078	0.183	6.798E-5	415	0.027	0.067	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7qqmA	0.083	0.202	7.625E-5	413	0.032	0.080	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7qqnC	0.079	0.192	1.207E-4	414	0.028	0.070	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q17RL8	0.0	632	775	0.360	0.481	Q17RL8_HUMAN HCG2004980, isoform CRA_e OS=Homo sapiens OX=9606 GN=PDZD4 PE=1 SV=1
2	Q69ZS0	0.0	1102	1063	0.600	0.585	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
3	Q6ZMN7	0.0	2152	1036	1.000	1.000	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
4	Q4H4B6	2.93e-18	93.2	1724	0.081	0.049	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
5	Q7ZW16	3.22e-17	86.3	318	0.042	0.138	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
6	Q9H4P4	6.07e-17	85.5	317	0.043	0.142	RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens OX=9606 GN=RNF41 PE=1 SV=2
7	Q8BH75	6.19e-17	85.5	317	0.043	0.142	RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus OX=10090 GN=Rnf41 PE=1 SV=1
8	Q8MR31	6.84e-16	85.1	767	0.041	0.055	SLIP1_DROME Slo-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Slip1 PE=1 SV=2
9	O75970	3.84e-15	83.2	2070	0.069	0.034	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
10	E2QYC9	8.80e-15	82.0	1828	0.078	0.044	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
11	Q8VBX6	2.25e-14	80.9	2055	0.075	0.038	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
12	Q9VUV7	3.13e-14	77.0	315	0.042	0.137	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
13	Q92796	6.47e-14	78.6	817	0.070	0.089	DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3 PE=1 SV=2
14	Q62936	9.66e-14	78.2	849	0.069	0.084	DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus OX=10116 GN=Dlg3 PE=1 SV=1
15	Q80U72	1.14e-13	78.2	1612	0.072	0.047	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
16	Q9WVJ4	1.52e-13	71.2	145	0.039	0.276	SYJ2B_RAT Synaptojanin-2-binding protein OS=Rattus norvegicus OX=10116 GN=Synj2bp PE=1 SV=2
17	P70175	1.65e-13	77.4	849	0.068	0.082	DLG3_MOUSE Disks large homolog 3 OS=Mus musculus OX=10090 GN=Dlg3 PE=1 SV=1
18	A0A8I6ANK4	2.63e-13	77.0	1589	0.069	0.045	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
19	D3ZWS0	2.74e-13	77.0	1638	0.069	0.044	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
20	A0A8I6APB3	2.94e-13	77.0	1610	0.069	0.045	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	4.7e-31	118.3	PDZ domain
2	PF13180 PDZ_2	1.4e-11	55.9	PDZ domain
3	PF17820 PDZ_6	1.8e-17	74.3	PDZ domain
4	PF02163 Peptidase_M50	8.6e-08	43.4	Peptidase family M50
5	PF14447 Prok-RING_4	3.6	18.9	Prokaryotic RING finger family 4
6	PF03145 Sina	36	15.8	Seven in absentia protein family
7	PF14685 Tricorn_PDZ	32	15.9	Tricorn protease PDZ domain
8	PF00097 zf-C3HC4	0.08	24.1	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	0.00091	30.3	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	0.74	21.0	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	5.6	18.5	zinc finger of C3HC4-type, RING
12	PF12678 zf-rbx1	14	17.4	RING-H2 zinc finger domain
13	PF13639 zf-RING_2	0.15	23.8	Ring finger domain
14	PF14634 zf-RING_5	0.93	20.8	zinc-RING finger domain
15	PF14835 zf-RING_6	94	14.3	zf-RING of BARD1-type protein
16	PF13445 zf-RING_UBOX	0.033	25.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384197

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325895	0.652	Ankyrin repeat and death domain containing 1A
2	9606.ENSP00000340271	0.635	Transcription initiation factor TFIID subunit 3
3	9606.ENSP00000397351	0.619	Delphilin
4	9606.ENSP00000299505	0.612	Uncharacterized protein KIAA0355
5	9606.ENSP00000373194	0.611	Olfactory receptor 5K3
6	9606.ENSP00000377086	0.564	LON peptidase N-terminal domain and ring finger 2
7	9606.ENSP00000416015	0.556	[F-actin]-monooxygenase MICAL3
8	9606.ENSP00000384638	0.555	Catenin alpha-2
9	9606.ENSP00000320849	0.551	Coiled-coil domain containing 184
10	9606.ENSP00000446688	0.547	PC-esterase domain containing 1B
11	9606.ENSP00000325929	0.538	Ligand of numb-protein X 2
12	9606.ENSP00000263925	0.533	E3 ubiquitin-protein ligase LNX
13	9606.ENSP00000282908	0.529	Serine/threonine kinase 32B
14	9606.ENSP00000304669	0.527	Catenin alpha-1
15	9606.ENSP00000457539	0.516	Apolipoprotein B receptor
16	9606.ENSP00000254730	0.512	Selenocysteine-specific elongation factor
17	9606.ENSP00000302144	0.507	Transmembrane protein 154
18	9606.ENSP00000373696	0.500	E3 ubiquitin-protein ligase TRIP12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.797	catalytic activity
GO:0140096	0.722	catalytic activity, acting on a protein
GO:0016740	0.477	transferase activity
GO:0004842	0.400	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0070647	0.904	protein modification by small protein conjugation or removal
GO:0071840	0.882	cellular component organization or biogenesis
GO:0050789	0.866	regulation of biological process
GO:0050794	0.814	regulation of cellular process
GO:0016043	0.776	cellular component organization
GO:0034330	0.507	cell junction organization
GO:0032446	0.394	protein modification by small protein conjugation
GO:0048518	0.354	positive regulation of biological process
GO:0016567	0.332	protein ubiquitination
GO:0050896	0.303	response to stimulus
GO:0019222	0.303	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005622	0.942	intracellular anatomical structure
GO:0030054	0.891	cell junction
GO:0016020	0.888	membrane
GO:0005886	0.841	plasma membrane
GO:0045202	0.811	synapse
GO:0005737	0.777	cytoplasm
GO:0043226	0.670	organelle
GO:0043229	0.528	intracellular organelle
GO:0043227	0.475	membrane-bounded organelle
GO:0043231	0.438	intracellular membrane-bounded organelle
GO:0005654	0.373	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.477	Transferases.

[back to server]