StarFunc result for job id Q6ZMP0

User Input

>input (1018 residues)
MVSHFMGSLSVLCFLLLLGFQFVCPQPSTQHRKVPQRMAAEGAPEDDGGGGAPGVWGAWG
PWSACSRSCSGGVMEQTRPCLPRSYRLRGGQRPGAPARAFADHVVSAVRTSVPLHRSRDE
TPALAGTDASRQGPTVLRGSRHPQPQGLEVTGDRRSRTRGTIGPGKYGYGKAPYILPLQT
DTAHTPQRLRRQKLSSRHSRSQGASSARHGYSSPAHQVPQHGPLYQSDSGPRSGLQAAEA
PIYQLPLTHDQGYPAASSLFHSPETSNNHGVGTHGATQSFSQPARSTAISCIGAYRQYKL
CNTNVCPESSRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQAMGYRFYVRQ
AEKVIDGTPCDQNGTAICVSGQCKSIGCDDYLGSDKVVDKCGVCGGDNTGCQVVSGVFKH
ALTSLGYHRVVEIPEGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGT
MFTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPH
RRPGEPFNGQMVTEGRSQEEGEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPH
RPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDS
SMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQ
HLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKL
RPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPA
EATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEK
PPSQQSCHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEERE
SCNPQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRQTGFLGSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UTY6	0.371	0.371	0.000	1018	0.875	0.875	Q3UTY6.pdb.gz	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
2	AFDB:Q6ZMP0	1.000	1.000	0.000	1018	1.000	1.000	Q6ZMP0.pdb.gz	THSD4_HUMAN Thrombospondin type-1 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THSD4 PE=1 SV=2
3	AFDB:Q8TE60	0.211	0.180	2.208E-60	1221	0.223	0.186	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
4	AFDB:E7FFX0	0.211	0.179	8.568E-60	1224	0.232	0.193	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
5	AFDB:Q69Z28	0.217	0.185	3.865E-59	1222	0.218	0.182	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
6	AFDB:E7FEJ5	0.218	0.183	3.892E-58	1244	0.222	0.182	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
7	AFDB:Q4VC17	0.213	0.182	5.261E-58	1219	0.231	0.193	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
8	AFDB:Q9UKP4	0.206	0.133	2.514E-42	1686	0.234	0.141	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
9	AFDB:Q769J6	0.214	0.158	8.511E-40	1426	0.181	0.129	Q769J6.pdb.gz	ATS13_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 13 OS=Mus musculus OX=10090 GN=Adamts13 PE=1 SV=1
10	PDB:1w0rA	0.103	0.198	1.786E-10	442	0.085	0.197	1w0rA.pdb.gz
11	PDB:4a5wB	0.056	0.064	2.183E-3	871	0.029	0.034	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
12	AFDB:B7YZW3	0.060	0.042	2.863E-3	2064	0.126	0.062	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
13	PDB:3t5oA	0.055	0.062	2.951E-3	871	0.046	0.054	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:4e0sB	0.060	0.065	1.891E-2	898	0.045	0.051	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
15	PDB:6y0fC	0.035	0.047	3.455E-2	722	0.032	0.046	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
16	PDB:4lnvA	0.058	0.048	4.670E-2	1276	0.044	0.035	4lnvA.pdb.gz
17	PDB:2n6fA	0.045	0.166	5.429E-2	136	0.021	0.154	2n6fA.pdb.gz
18	PDB:2xe4A	0.025	0.033	6.312E-2	721	0.027	0.037	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
19	PDB:3afkA	0.076	0.319	6.979E-2	167	0.010	0.060	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
20	PDB:5y31B	0.028	0.049	7.716E-2	511	0.035	0.070	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UTY6	0.0	1830	1018	0.867	0.867	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
2	Q6UY14	0.0	639	1074	0.322	0.305	ATL4_HUMAN ADAMTS-like protein 4 OS=Homo sapiens OX=9606 GN=ADAMTSL4 PE=1 SV=2
3	Q6ZMP0	0.0	2113	1018	1.000	1.000	THSD4_HUMAN Thrombospondin type-1 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THSD4 PE=1 SV=2
4	Q80T21	0.0	613	1036	0.329	0.323	ATL4_MOUSE ADAMTS-like protein 4 OS=Mus musculus OX=10090 GN=Adamtsl4 PE=2 SV=1
5	Q8TE60	1.89e-79	285	1221	0.186	0.155	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	P59510	1.94e-78	284	1910	0.219	0.117	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	D3ZLL7	6.56e-78	280	1221	0.185	0.154	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
8	Q9UKP5	7.11e-78	279	1117	0.176	0.160	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
9	Q9P2N4	1.74e-77	281	1935	0.226	0.119	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
10	Q69Z28	4.23e-77	278	1222	0.189	0.157	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
11	Q4VC17	1.65e-76	276	1219	0.185	0.154	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
12	D3Z1A5	3.13e-76	274	1117	0.175	0.159	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
13	F1SFS3	4.37e-76	277	2000	0.227	0.116	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
14	O76840	4.29e-75	274	2167	0.208	0.098	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
15	E9PUN6	4.63e-73	268	1931	0.206	0.109	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
16	E9PYV8	4.63e-73	266	1350	0.212	0.160	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
17	E7FEJ5	6.44e-72	263	1244	0.189	0.154	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
18	Q868Z9	1.65e-70	260	2898	0.195	0.069	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
19	E1JHE3	2.02e-70	254	879	0.201	0.233	E1JHE3_DROME Lonely heart, isoform D OS=Drosophila melanogaster OX=7227 GN=loh PE=4 SV=2
20	Q8MSF8	2.28e-70	254	880	0.201	0.233	Q8MSF8_DROME GM15606p OS=Drosophila melanogaster OX=7227 GN=loh PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19236 ADAMTS_CR_3	1.4e-10	52.6	ADAMTS cysteine-rich domain
2	PF05986 ADAMTS_spacer1	1.1e-25	101.5	ADAM-TS Spacer 1
3	PF08686 PLAC	1.5e-06	40.1	PLAC (protease and lacunin) domain
4	PF19030 TSP1_ADAMTS	1.1e-68	238.7	Thrombospondin type 1 domain
5	PF19035 TSP1_CCN	2.4e-10	51.9	CCN3 Nov like TSP1 domain
6	PF19028 TSP1_spondin	1.7e-07	42.7	Spondin-like TSP1 domain
7	PF00090 TSP_1	2.1e-23	93.5	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.935	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000343002	0.933	Beta-1,3-glucosyltransferase
3	9606.ENSP00000270328	0.930	A disintegrin and metalloproteinase with thrombospondin motifs 10
4	9606.ENSP00000258613	0.925	Thrombospondin type-1 domain-containing protein 1
5	9606.ENSP00000247153	0.922	Properdin
6	9606.ENSP00000268070	0.922	ADAM metallopeptidase with thrombospondin type 1 motif 17
7	9606.ENSP00000369921	0.921	ADAMTS-like protein 1
8	9606.ENSP00000346478	0.920	ADAMTS-like protein 2
9	9606.ENSP00000284984	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 1
10	9606.ENSP00000362304	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 14
11	9606.ENSP00000260356	0.917	Thrombospondin-1
12	9606.ENSP00000370443	0.917	ADAM metallopeptidase with thrombospondin type 1 motif 6
13	9606.ENSP00000274487	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 19
14	9606.ENSP00000374071	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 20
15	9606.ENSP00000418735	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 9
16	9606.ENSP00000483599	0.916	Spondin-2
17	9606.ENSP00000327608	0.915	ADAMTS-like protein 5
18	9606.ENSP00000422554	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 12
19	9606.ENSP00000406482	0.914	Thrombospondin type-1 domain-containing protein 7A
20	9606.ENSP00000286744	0.911	ADAMTS-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.815	catalytic activity
GO:0140096	0.620	catalytic activity, acting on a protein
GO:0016787	0.554	hydrolase activity
GO:0008233	0.429	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.926	cellular component organization
GO:0022607	0.656	cellular component assembly
GO:0097435	0.655	supramolecular fiber organization
GO:0065007	0.429	biological regulation
GO:0050789	0.423	regulation of biological process
GO:0050794	0.378	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.998	extracellular matrix
GO:0005576	0.972	extracellular region
GO:0043226	0.941	organelle
GO:0001527	0.915	microfibril
GO:0062023	0.870	collagen-containing extracellular matrix
GO:0043227	0.864	membrane-bounded organelle
GO:0005622	0.738	intracellular anatomical structure
GO:0043229	0.709	intracellular organelle
GO:0005737	0.699	cytoplasm
GO:0043231	0.681	intracellular membrane-bounded organelle
GO:0070062	0.599	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.554	Hydrolases.
EC:3.4.-.-	0.429	Acting on peptide bonds (peptidases).

[back to server]