StarFunc result for job id Q6ZMQ8

User Input

>input (1374 residues)
MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGI
GFKEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDV
GRHSLLYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRAL
KHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACG
VLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFVTADQLWVPLRWIAPE
LVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPK
PQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPG
GGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYK
WEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPA
AGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLA
RDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTG
EDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPE
PGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEP
KLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKL
ASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTP
DSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEP
QAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRA
PGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPSGLVPEP
PEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPR
APLRLALPGLPAALEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAE
SQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAK
ESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPA
APAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMQ8	0.999	0.999	0.000	1374	1.000	1.000	Q6ZMQ8.pdb.gz	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
2	AFDB:Q80YE4	0.321	0.323	0.000	1365	0.734	0.738	Q80YE4.pdb.gz	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
3	AFDB:Q8IWU2	0.254	0.234	2.997E-55	1503	0.353	0.323	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
4	AFDB:Q96Q04	0.222	0.209	2.312E-53	1460	0.341	0.321	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
5	AFDB:D3ZBH5	0.160	0.144	8.322E-39	1531	0.322	0.289	D3ZBH5.pdb.gz	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
6	AFDB:P00522	0.177	0.151	1.746E-19	1620	0.163	0.138	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
7	AFDB:P42684	0.171	0.197	7.569E-19	1182	0.132	0.153	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
8	AFDB:E9PT20	0.177	0.211	7.992E-19	1143	0.132	0.158	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
9	AFDB:F7BN18	0.175	0.211	1.619E-18	1128	0.130	0.158	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	AFDB:Q9I7F7	0.184	0.189	1.906E-18	1337	0.166	0.171	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
11	PDB:4fl2A	0.175	0.414	1.399E-17	555	0.060	0.150	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2h8hA	0.173	0.497	1.702E-16	445	0.060	0.184	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4k2rA	0.174	0.416	5.624E-16	551	0.055	0.138	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.167	0.499	1.416E-15	441	0.060	0.188	1k9aB.pdb.gz
15	PDB:6s73A	0.174	0.789	5.392E-14	269	0.044	0.227	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:1unlA	0.162	0.687	1.598E-13	292	0.047	0.223	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:8dksA	0.157	0.675	1.781E-13	283	0.049	0.240	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4eomC	0.162	0.729	1.013E-12	276	0.039	0.192	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:4krcA	0.155	0.648	2.416E-12	297	0.041	0.192	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:4btfA	0.156	0.477	3.171E-12	413	0.036	0.119	4btfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZMQ8	0.0	2739	1374	1.000	1.000	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
2	Q80YE4	0.0	1701	1365	0.726	0.731	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
3	Q96Q04	3.93e-152	500	1460	0.194	0.182	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
4	Q8IWU2	8.99e-142	473	1503	0.185	0.169	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
5	D3ZBH5	3.32e-141	473	1631	0.182	0.153	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
6	Q13308	1.45e-42	172	1070	0.087	0.111	PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2
7	Q6PA07	2.44e-42	171	1043	0.090	0.119	Q6PA07_XENLA MGC68806 protein OS=Xenopus laevis OX=8355 GN=ptk7.L PE=1 SV=1
8	B7SNG4	6.31e-42	171	1353	0.077	0.078	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
9	Q9PWN6	1.97e-41	168	989	0.076	0.105	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q8BKG3	4.07e-41	167	1062	0.090	0.116	PTK7_MOUSE Inactive tyrosine-protein kinase 7 OS=Mus musculus OX=10090 GN=Ptk7 PE=1 SV=1
11	P06213	5.24e-41	168	1382	0.076	0.076	INSR_HUMAN Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4
12	Q05688	8.79e-41	163	640	0.071	0.152	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
13	Q6B515	6.42e-40	161	669	0.078	0.160	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
14	Q63604	8.43e-40	162	821	0.078	0.130	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
15	P15209	1.42e-39	161	821	0.078	0.130	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
16	Q1LVG4	1.44e-39	163	1348	0.073	0.074	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
17	F7DGW1	1.47e-39	161	838	0.078	0.128	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
18	Q16620	1.49e-39	161	822	0.078	0.130	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
19	Q548C2	1.49e-39	161	822	0.078	0.130	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
20	O73798	1.83e-39	162	1358	0.071	0.072	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	3.7e-30	116.8	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	5.8e-58	207.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324196

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419782	0.755	Cyclin-dependent-like kinase 5
2	9606.ENSP00000262301	0.688	Lipase maturation factor 1
3	9606.ENSP00000375649	0.531	Myeloid associated differentiation marker
4	9606.ENSP00000225474	0.520	Granulocyte colony-stimulating factor
5	9606.ENSP00000348278	0.511	STE20/SPS1-related proline-alanine-rich protein kinase
6	9606.ENSP00000389009	0.503	Carnosine synthase 1
7	9606.ENSP00000409924	0.501	PTGES3L-AARSD1 readthrough
8	9606.ENSP00000391167	0.500	C-myc promoter-binding protein
9	9606.ENSP00000400870	0.500	Alanyl-tRNA editing protein Aarsd1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	0.975	protein kinase activity
GO:0004713	0.415	protein tyrosine kinase activity
GO:0004674	0.366	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.978	multicellular organismal process
GO:0071704	0.933	organic substance metabolic process
GO:0044237	0.923	cellular metabolic process
GO:0044238	0.922	primary metabolic process
GO:0050789	0.900	regulation of biological process
GO:1901564	0.880	organonitrogen compound metabolic process
GO:0006793	0.851	phosphorus metabolic process
GO:0032502	0.850	developmental process
GO:0048856	0.827	anatomical structure development
GO:0019538	0.818	protein metabolic process
GO:0050794	0.802	regulation of cellular process
GO:0007275	0.792	multicellular organism development
GO:0006796	0.739	phosphate-containing compound metabolic process
GO:0036211	0.722	protein modification process
GO:0048731	0.703	system development
GO:0018193	0.650	peptidyl-amino acid modification
GO:0006468	0.635	protein phosphorylation
GO:0007399	0.580	nervous system development
GO:0008219	0.563	cell death
GO:0023051	0.327	regulation of signaling
GO:0010646	0.317	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0016020	0.997	membrane
GO:0043227	0.980	membrane-bounded organelle
GO:0005737	0.978	cytoplasm
GO:0043229	0.976	intracellular organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005886	0.949	plasma membrane
GO:0005829	0.910	cytosol
GO:0005634	0.575	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.975	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.415	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]