StarFunc result for job id Q6ZMT1

User Input

>input (411 residues)
MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSEL
KCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKR
ASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVH
EPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELT
EDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVAL
YKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQ
PFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMT1	1.000	1.000	1.346E-65	411	1.000	1.000	Q6ZMT1.pdb.gz	STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1
2	AFDB:Q9BX66	0.147	0.048	4.880E-8	1292	0.212	0.067	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
3	AFDB:A9P3U3	0.162	0.090	6.671E-7	774	0.146	0.078	A9P3U3.pdb.gz	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
4	AFDB:Q9VE96	0.132	0.093	2.997E-6	600	0.173	0.118	Q9VE96.pdb.gz	Q9VE96_DROME LD44138p OS=Drosophila melanogaster OX=7227 GN=l(3)05822 PE=1 SV=1
5	AFDB:Q9W0K0	0.136	0.115	2.624E-5	490	0.158	0.133	Q9W0K0.pdb.gz	JIP1_DROME JNK-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Aplip1 PE=1 SV=2
6	AFDB:Q10929	0.144	0.128	8.443E-5	469	0.156	0.136	Q10929.pdb.gz	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
7	AFDB:A0A0B4K6C1	0.143	0.070	9.976E-5	1034	0.156	0.062	A0A0B4K6C1.pdb.gz	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
8	AFDB:Q10199	0.133	0.082	9.976E-5	670	0.175	0.107	Q10199.pdb.gz	IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp2 PE=1 SV=1
9	PDB:3ehqA	0.142	0.310	2.175E-4	182	0.049	0.110	3ehqA.pdb.gz
10	AFDB:O43150	0.147	0.061	2.716E-4	1006	0.175	0.072	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
11	PDB:2dybA	0.137	0.188	2.717E-4	298	0.051	0.070	2dybA.pdb.gz
12	AFDB:P49418	0.144	0.090	2.871E-4	695	0.148	0.088	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
13	PDB:4mt6A	0.128	0.135	3.794E-4	389	0.056	0.059	4mt6A.pdb.gz
14	PDB:6x5hA	0.136	0.120	6.260E-4	467	0.032	0.028	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
15	PDB:1k9aB	0.134	0.125	7.397E-4	441	0.054	0.050	1k9aB.pdb.gz
16	PDB:2lqnA	0.130	0.174	8.268E-4	303	0.058	0.079	2lqnA.pdb.gz
17	PDB:3qwyA	0.133	0.317	9.770E-4	170	0.046	0.112	3qwyA.pdb.gz
18	PDB:2h8hA	0.123	0.114	1.364E-3	445	0.039	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:1griA	0.141	0.272	2.516E-3	211	0.054	0.104	1griA.pdb.gz
20	PDB:1k0xA	0.133	0.462	2.516E-3	108	0.044	0.167	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZMT1	0.0	839	411	1.000	1.000	STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1
2	Q8R1B0	0.0	727	408	0.934	0.941	STAC2_MOUSE SH3 and cysteine-rich domain-containing protein 2 OS=Mus musculus OX=10090 GN=Stac2 PE=1 SV=1
3	P97306	2.41e-102	311	403	0.457	0.467	STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Stac PE=1 SV=1
4	Q99469	3.17e-96	295	402	0.453	0.463	STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
5	Q8WUK8	1.34e-95	294	402	0.450	0.460	Q8WUK8_HUMAN SH3 and cysteine rich domain OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
6	Q96MF2	4.26e-63	209	364	0.280	0.316	STAC3_HUMAN SH3 and cysteine-rich domain-containing protein 3 OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
7	Q8BZ71	1.30e-62	207	360	0.285	0.325	STAC3_MOUSE SH3 and cysteine-rich domain-containing protein 3 OS=Mus musculus OX=10090 GN=Stac3 PE=1 SV=1
8	Q6DBR6	1.64e-56	191	334	0.263	0.323	STAC3_DANRE SH3 and cysteine-rich domain-containing protein 3 OS=Danio rerio OX=7955 GN=stac3 PE=1 SV=1
9	G3V5D4	1.10e-13	70.9	168	0.073	0.179	G3V5D4_HUMAN SH3 and cysteine rich domain 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
10	A8DYE9	1.27e-12	71.6	546	0.083	0.062	A8DYE9_DROME Stac-like, isoform E OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=2
11	A0A0B4KG20	3.83e-12	70.5	1166	0.083	0.029	A0A0B4KG20_DROME Stac-like, isoform H OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	A0A0B4KFR2	4.24e-12	70.5	1951	0.083	0.017	A0A0B4KFR2_DROME Stac-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
13	A0A0B4KER3	4.52e-12	70.5	1156	0.083	0.029	A0A0B4KER3_DROME Stac-like, isoform O OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
14	A0A0B4KEV7	4.68e-12	70.5	1970	0.083	0.017	A0A0B4KEV7_DROME Stac-like, isoform J OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
15	A0A0B4LFI1	5.49e-12	70.1	1089	0.083	0.031	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
16	A0A0B4LGK0	5.74e-12	70.1	1198	0.083	0.028	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
17	Q9NHV9	7.49e-12	69.7	793	0.165	0.086	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
18	Q06449	4.82e-10	61.2	215	0.066	0.126	PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIN3 PE=1 SV=1
19	Q08012	5.00e-10	61.2	211	0.061	0.118	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
20	P16086	4.92e-09	60.8	2472	0.073	0.012	SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.00082	30.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	14	17.4	C1 domain
3	PF11302 DUF3104	7.7e+02	11.1	Protein of unknown function (DUF3104)
4	PF00018 SH3_1	1.1e-09	49.0	SH3 domain
5	PF07653 SH3_2	4.3e-10	50.6	Variant SH3 domain
6	PF14604 SH3_9	7.5e-14	62.7	Variant SH3 domain
7	PF16664 STAC2_u1	5.2e-41	151.4	Unstructured on SH3 and cysteine-rich domain-containing protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355192	0.929	Voltage-dependent L-type calcium channel subunit alpha-1S
2	9606.ENSP00000415822	0.741	Ataxin-1-like
3	9606.ENSP00000247665	0.698	14 kDa phosphohistidine phosphatase
4	9606.ENSP00000354085	0.627	Ankyrin repeat and KH domain-containing protein 1
5	9606.ENSP00000388638	0.614	Splicing factor 45
6	9606.ENSP00000266068	0.594	Glucocorticoid modulatory element-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:1903169	0.966	regulation of calcium ion transmembrane transport
GO:0048522	0.948	positive regulation of cellular process
GO:1901019	0.933	regulation of calcium ion transmembrane transporter activity
GO:0009987	0.932	cellular process
GO:2001257	0.927	regulation of cation channel activity
GO:2001259	0.873	positive regulation of cation channel activity
GO:1901385	0.786	regulation of voltage-gated calcium channel activity
GO:1901021	0.784	positive regulation of calcium ion transmembrane transporter activity
GO:1903078	0.726	positive regulation of protein localization to plasma membrane
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.949	intracellular anatomical structure
GO:0005737	0.927	cytoplasm
GO:0043226	0.837	organelle
GO:0043229	0.825	intracellular organelle
GO:0019898	0.790	extrinsic component of membrane
GO:0043227	0.764	membrane-bounded organelle
GO:0043231	0.731	intracellular membrane-bounded organelle
GO:0009898	0.698	cytoplasmic side of plasma membrane
GO:0019897	0.683	extrinsic component of plasma membrane
GO:0031234	0.672	extrinsic component of cytoplasmic side of plasma membrane
GO:0005829	0.323	cytosol
GO:0070013	0.311	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]