StarFunc result for job id Q6ZMW3

User Input

>input (1958 residues)
MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGH
NDDIISLALHPDKTLVATGQVGKEPYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQR
LASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLC
GNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGI
FSMYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKADRLLAGT
QDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALI
ARCNMEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDG
SYLAVGSNDGPVDVYAVAQRYKKIGECSKSLSFITHIDWSLDSKYLQTNDGAGERLFYRM
PSGKPLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFG
LVKLFKFPCLKRGAKFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSN
GMLETAPQEGGADSYSEESDSDLSDVPELDSDIEQEAQINYDRQVYKEDLPQLKQQSKEK
NHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQ
RLYLGHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDF
SADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHI
KFWQQAGGGFTSKRGTFGSVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDILLLKTVK
AHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPS
IRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDK
TLRIWELSAQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHH
RKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLL
QVNSGAREQLFFEAPRGKRHIIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAAS
LTKDCSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGAD
TALMIWTREFVGTQESKLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYAVSIREMEG
TKPHQQLKEVSVEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNL
HYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTT
PSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVA
SRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSLGAAKMQTMLS
VAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTK
EGGAVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNI
LIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYSPDG
EMVAIGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDLT
QGTNLNRIGYCKDIPSFVIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAVVIEKIT
WASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTEKFAKH
KRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05BV3	0.688	0.684	0.000	1969	0.748	0.744	Q05BV3.pdb.gz	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
2	AFDB:Q96KV7	0.269	0.298	7.050E-72	1748	0.138	0.155	Q96KV7.pdb.gz	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
3	AFDB:O95834	0.295	0.878	7.522E-64	649	0.119	0.359	O95834.pdb.gz	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
4	AFDB:A0A0R4INC0	0.295	0.681	1.540E-63	840	0.113	0.263	A0A0R4INC0.pdb.gz
5	AFDB:O00423	0.294	0.700	1.308E-61	815	0.112	0.269	O00423.pdb.gz	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
6	AFDB:B5MBZ0	0.294	0.577	7.233E-60	992	0.111	0.220	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
7	AFDB:Q3UMY5	0.293	0.577	1.692E-58	988	0.110	0.219	Q3UMY5.pdb.gz	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
8	AFDB:Q32P44	0.293	0.633	2.048E-58	896	0.103	0.225	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
9	AFDB:Q9VUI3	0.286	0.514	2.721E-48	1076	0.079	0.144	Q9VUI3.pdb.gz	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
10	AFDB:O45487	0.286	0.617	5.463E-46	891	0.073	0.160	O45487.pdb.gz	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
11	PDB:7rroe	0.259	0.780	1.531E-29	610	0.059	0.189	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7mqaLQ	0.083	0.161	4.549E-28	830	0.061	0.143	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:1nr0A	0.244	0.694	5.005E-28	610	0.047	0.152	1nr0A.pdb.gz
14	PDB:7mq8LR	0.221	0.486	1.575E-27	773	0.046	0.118	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8LO	0.087	0.190	2.930E-27	848	0.064	0.149	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6jp6A	0.117	0.178	3.224E-27	998	0.066	0.130	6jp6A.pdb.gz
17	PDB:7mqaLO	0.088	0.199	3.547E-27	819	0.057	0.137	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3sfzA	0.076	0.122	2.514E-26	1133	0.065	0.113	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
19	PDB:7ajtUA	0.075	0.152	9.131E-26	834	0.058	0.135	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7ajuUL	0.205	0.449	4.633E-25	779	0.049	0.123	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05BV3	0.0	3155	1969	0.749	0.745	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
2	Q6P6T4	1.46e-121	401	649	0.120	0.362	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
3	O95834	2.30e-120	397	649	0.120	0.361	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
4	E7EXY5	4.56e-119	399	813	0.115	0.277	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
5	A0A2R8RMY7	5.46e-119	399	817	0.115	0.275	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
6	Q05BC3	7.79e-117	393	814	0.114	0.275	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
7	O00423	1.22e-115	390	815	0.115	0.276	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
8	B5MBZ0	1.42e-109	377	992	0.118	0.233	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
9	Q9HC35	1.62e-109	377	981	0.118	0.235	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
10	Q3UMY5	1.83e-107	371	988	0.117	0.232	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
11	Q32P44	2.28e-91	321	896	0.111	0.242	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
12	A0A0C4DGQ7	1.09e-62	223	427	0.068	0.311	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
13	Q9VUI3	3.50e-56	216	1076	0.088	0.161	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
14	Q96KV7	5.70e-47	189	1748	0.154	0.173	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
15	C4ALD8	4.31e-40	164	888	0.082	0.181	C4ALD8_CAEEL HELP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
16	O45487	6.35e-40	164	891	0.082	0.181	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
17	Q96MT7	1.24e-30	135	1854	0.066	0.070	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
18	E9Q5M6	2.13e-29	131	1843	0.062	0.066	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
19	A8IRK7	1.96e-20	101	815	0.059	0.141	CF251_CHLRE Cilia- and flagella-associated protein 251 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP251 PE=1 SV=1
20	Q57YK0	2.88e-19	96.7	638	0.052	0.158	Q57YK0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.880 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	6.1e-32	121.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	0.023	24.9	Cytochrome D1 heme domain
3	PF18975 DUF5711	4.3e+02	11.5	Family of unknown function (DUF5711)
4	PF20138 DUF6528	0.21	22.0	Family of unknown function (DUF6528)
5	PF11768 Frtz	3	17.7	WD repeat-containing and planar cell polarity effector protein Fritz
6	PF16529 Ge1_WD40	0.00097	29.8	WD40 region of Ge1, enhancer of mRNA-decapping protein
7	PF03451 HELP	1.2e-53	190.2	HELP motif
8	PF10159 MMtag	2.8e+02	13.2	Multiple myeloma tumor-associated
9	PF20426 NBCH_WD40	8.5e-07	39.7	Neurobeachin beta propeller domain
10	PF08801 Nucleoporin_N	0.0086	26.5	Nup133 N terminal like
11	PF07676 PD40	0.66	21.3	WD40-like Beta Propeller Repeat
12	PF00400 WD40	1.2e-61	214.3	WD domain, G-beta repeat
13	PF17005 WD40_like	0.022	25.7	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279024	0.763	Uncharacterized protein KIAA1755
2	9606.ENSP00000268184	0.642	CREB-regulated transcription coactivator 3
3	9606.ENSP00000259818	0.633	Tubulin beta-2B chain
4	9606.ENSP00000380479	0.622	ELAV-like protein 2
5	9606.ENSP00000381773	0.618	DNA topoisomerase 3-beta-1
6	9606.ENSP00000480615	0.618	Anthrax toxin receptor like
7	9606.ENSP00000384527	0.613	Zinc finger and BTB domain-containing protein 40
8	9606.ENSP00000352927	0.608	Microtubule cross-linking factor 1
9	9606.ENSP00000261486	0.606	Erythrocyte membrane protein band 4.1 like 4A
10	9606.ENSP00000438040	0.573	Coiled-coil domain-containing protein 91
11	9606.ENSP00000230671	0.561	Sodium-dependent proline transporter
12	9606.ENSP00000254488	0.554	Sodium- and chloride-dependent GABA transporter 3
13	9606.ENSP00000339260	0.554	Sodium- and chloride-dependent GABA transporter 2
14	9606.ENSP00000372459	0.526	CBP80/20-dependent translation initiation factor
15	9606.ENSP00000322730	0.502	Integral membrane protein 2C
16	9606.ENSP00000361095	0.500	Transmembrane protein 69

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.416	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.957	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005622	0.990	intracellular anatomical structure
GO:0043229	0.972	intracellular organelle
GO:0043232	0.878	intracellular non-membrane-bounded organelle
GO:0005737	0.851	cytoplasm
GO:0005576	0.830	extracellular region
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0031982	0.708	vesicle
GO:0005829	0.683	cytosol
GO:0005615	0.676	extracellular space
GO:1903561	0.676	extracellular vesicle
GO:0005634	0.672	nucleus
GO:0070062	0.670	extracellular exosome
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]