StarFunc result for job id Q6ZMY3

User Input

>input (1216 residues)
MSQAGDVEGPSTGDPVLSPQHNCELLQNMEGASSMPGLSPDGPGASSGPGVRAGSRRKIP
RKEALRGGSSRAAGAAEVRPGVLELLAVVQSRGSMLAPGLHMQLPSVPTQGRALTSKRLQ
VSLCDILDDSCPRKLCSRSAGLPERALACRERLAGVEEVSCLRPREARDGGMSSPGCDRR
SPTLSKEEPPGRPLTSSPDPVPVRVRKKWRRQGAHSECEEGAGDFLWLDQSPRGDNLLSV
GDPPQVADLESLGGPCRPPSPKDTGSGPGEPGGSGAGCASGTEKFGYLPATGDGPQPGSP
CGPVGFPVPSGGESLSSAAQAPPQSAALCLGASAQASAEQQEAVCVVRTGSDEGQAPAQD
QEELEAKAQPASRGRLEQGLAAPADTCASSREPLGGLSSSLDTEASRACSGPFMEQRRSK
GTKNLKKGPVPCAQDRGTDRSSDNSHQDRPEEPSPGGCPRLEEVKIPHGVKLVCYLGSGP
VIQLLGAISHGQAGGQLPPKLEVLEDLMEVSSPSPAQRLRRKKRPMVQGPAGCQVFQPSP
SGGTAGDPGGLSDPFYPPRSGSLALGDPSSDPACSQSGPMEAEEDSLPEQPEDSAQLQQE
KPSLYIGVRGTVVRSMQEVLWTRLRELPDPVLSEEVVEGIAAGIEAALWDLTQGTNGRYK
TKYRSLLFNLRDPRNLDLFLKVVHGDVTPYDLVRMSSMQLAPQELARWRDQEEKRGLNII
EQQQKEPCRLPASKMTHKGEVEIQRDMDQTLTLEDLVGPQMFMDCSPQALPIASEDTTGQ
HDHHFLDPNCHICKDWEPSNELLGSFEAAKSCGDNIFQKALSQTPMPAPEMPKTRELSPT
EPQDRVPPSGLHVPAAPTKALPCLPPWEGVLDMFSIKRFRARAQLVSGHSCRLVQALPTV
IRSAGCIPSNIVWDLLASICPAKAKDVCVVRLCPHGARDTQNCRLLYSYLNDRQRHGLAS
VEHMGMVLLPLPAFQPLPTRLRPLGGPGLWALPVSPLLSPGLEVTHSSLLLAVLLPKEGL
PDTAGSSPWLGKVQKMVSFNSKVEKRYYQPDDRRPNVPLKGTPPPGGAWQQSQGRGSIAP
RGISAWQRPPRGRGRLWPEPENWQHPGRGQWPPEPGLRQSQHPYSVAPAGHGFGRGQHFH
RDSCPHQALLRHLESLATMSHQLQALLCPQTKSSIPRPLQRLSSALAAPEPPGPARDSSL
GPTDEAGSECPFPRKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4KE59	0.107	0.102	9.890E-9	1311	0.137	0.127	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
2	AFDB:F4IN78	0.060	0.057	1.371E-5	1366	0.164	0.146	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
3	AFDB:Q8SY33	0.055	0.051	1.738E-4	1384	0.159	0.139	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
4	AFDB:M9NE38	0.042	0.035	3.766E-4	1912	0.128	0.082	M9NE38.pdb.gz	JV_DROME Protein javelin OS=Drosophila melanogaster OX=7227 GN=jv PE=4 SV=1
5	AFDB:Q9W283	0.042	0.040	3.766E-4	1329	0.119	0.109	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
6	AFDB:D3ZRA6	0.039	0.032	6.191E-4	1683	0.175	0.127	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
7	PDB:5iy6U	0.087	0.507	7.682E-4	170	0.023	0.165	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
8	AFDB:Q7TT18	0.037	0.036	8.623E-4	1306	0.146	0.136	Q7TT18.pdb.gz	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
9	AFDB:G0SAK3	0.046	0.036	1.018E-3	1793	0.149	0.101	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1
10	AFDB:Q3V089	0.062	0.071	1.075E-3	1013	0.117	0.140	Q3V089.pdb.gz	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
11	AFDB:Q3LHL9	0.051	0.043	1.673E-3	1658	0.155	0.113	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
12	PDB:6sn1B	0.082	0.174	2.491E-2	503	0.023	0.056	6sn1B.pdb.gz
13	PDB:4bxzX	0.079	0.651	2.633E-2	113	0.023	0.248	4bxzX.pdb.gz	Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
14	PDB:7nfcC	0.075	0.174	6.731E-2	477	0.021	0.055	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
15	PDB:1jeqA	0.074	0.153	7.644E-1	548	0.016	0.035	1jeqA.pdb.gz
16	PDB:6hivCb	0.052	0.173	8.537E-1	252	0.025	0.123	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:5y58A	0.073	0.147	1.007	548	0.012	0.026	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
18	PDB:1e03L	0.034	0.069	1.065	423	0.016	0.045	1e03L.pdb.gz	Structure of Beta-Antithrombin and the Effect of Glycosylation on Antithrombin'S Heparin Affinity and Activity.
19	PDB:7xk7D	0.039	0.140	1.257	206	0.012	0.068	7xk7D.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
20	PDB:6zheC	0.069	0.113	1.483	705	0.017	0.030	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1ASB6	0.0	780	1015	0.440	0.527	SPOC1_MOUSE SPOC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spocd1 PE=1 SV=3
2	Q8C9B9	2.32e-26	120	2256	0.056	0.030	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
3	Q9BTC0	5.16e-24	112	2240	0.053	0.029	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
4	Q9VG78	3.48e-17	90.1	2016	0.048	0.029	Q9VG78_DROME Protein partner of snf, isoform A OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
5	A0A0B4K6G3	3.57e-17	90.1	2018	0.048	0.029	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
6	P36106	6.84e-06	52.8	594	0.035	0.072	BYE1_YEAST Transcription factor BYE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BYE1 PE=1 SV=1
7	Q9ZVH8	1.33e-05	51.2	378	0.020	0.063	RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana OX=3702 GN=TFIIS PE=1 SV=1
8	Q15560	1.82e-05	50.4	299	0.025	0.104	TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
9	Q6IB64	1.82e-05	50.4	299	0.025	0.104	Q6IB64_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 GN=TCEA2 PE=2 SV=1
10	A0A1W2PRL9	6.43e-05	48.5	280	0.031	0.136	A0A1W2PRL9_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
11	A0A384MTX4	7.23e-05	48.5	301	0.031	0.126	A0A384MTX4_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 PE=2 SV=1
12	P23193	7.23e-05	48.5	301	0.031	0.126	TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2
13	A0A1W2PPZ5	7.36e-05	48.5	301	0.031	0.126	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
14	Q9Y7V2	7.45e-05	49.7	721	0.065	0.110	BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bye1 PE=3 SV=3
15	Q4KLL0	1.28e-04	47.8	301	0.025	0.100	TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=1 SV=1
16	P10711	1.55e-04	47.8	301	0.025	0.100	TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus OX=10090 GN=Tcea1 PE=1 SV=2
17	P23881	2.25e-04	47.4	347	0.018	0.063	TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus OX=10090 GN=Tcea3 PE=1 SV=3
18	Q63799	0.001	45.1	299	0.024	0.097	TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus OX=10116 GN=Tcea2 PE=2 SV=1
19	O75764	0.002	44.3	348	0.017	0.060	TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens OX=9606 GN=TCEA3 PE=1 SV=2
20	P07273	0.002	44.3	309	0.032	0.126	TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DST1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07744 SPOC	4.5e-24	96.6	SPOC domain
2	PF07500 TFIIS_M	1.7e-18	78.5	Transcription factor S-II (TFIIS), central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406026	0.646	SH2 domain-containing protein 5
2	9606.ENSP00000428426	0.639	Transcription elongation factor A protein 1
3	9606.ENSP00000406293	0.611	Transcription elongation factor A protein 3
4	9606.ENSP00000254624	0.610	Protein EFR3 homolog A
5	9606.ENSP00000307208	0.563	Nucleosome-remodeling factor subunit BPTF
6	9606.ENSP00000247270	0.554	Protein EVI2A
7	9606.ENSP00000331626	0.546	Zinc finger protein with KRAB and SCAN domains 2
8	9606.ENSP00000364912	0.520	Msx2-interacting protein
9	9606.ENSP00000377001	0.517	Speckle-type POZ protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0050789	0.989	regulation of biological process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0090304	0.975	nucleic acid metabolic process
GO:0043412	0.965	macromolecule modification
GO:0048523	0.913	negative regulation of cellular process
GO:0044260	0.619	cellular macromolecule metabolic process
GO:0010528	0.519	regulation of transposition
GO:0019222	0.452	regulation of metabolic process
GO:0010467	0.437	gene expression
GO:0044249	0.426	cellular biosynthetic process
GO:0016070	0.424	RNA metabolic process
GO:1901576	0.423	organic substance biosynthetic process
GO:0006304	0.412	DNA modification
GO:0009059	0.411	macromolecule biosynthetic process
GO:0044271	0.410	cellular nitrogen compound biosynthetic process
GO:0080090	0.404	regulation of primary metabolic process
GO:0060255	0.402	regulation of macromolecule metabolic process
GO:1901362	0.402	organic cyclic compound biosynthetic process
GO:0018130	0.402	heterocycle biosynthetic process
GO:0051171	0.397	regulation of nitrogen compound metabolic process
GO:0048609	0.388	multicellular organismal reproductive process
GO:0003006	0.385	developmental process involved in reproduction
GO:0034654	0.369	nucleobase-containing compound biosynthetic process
GO:0010529	0.362	negative regulation of transposition
GO:0007283	0.358	spermatogenesis
GO:0032259	0.336	methylation
GO:0043414	0.330	macromolecule methylation
GO:0010468	0.327	regulation of gene expression
GO:0006305	0.315	DNA alkylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.975	intracellular organelle lumen
GO:0005654	0.973	nucleoplasm
GO:0032991	0.380	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]