StarFunc result for job id Q6ZMZ3

User Input

>input (975 residues)
MTQQPQDDFDRSVEDAQAWMKAVQDQLQVNDNTQGPRAALEARLWETEKICQLEPEGRVR
VDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQLSHAQVLLHNVDNQAVLLDRLLEEAASL
FNRIGDPSVDEDAQKRMKAEYDAVKAKAQKRVDLLEQVAREHEEYQAGVDEFQLWLKAVV
EKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLEEQSAGVIRNTSPLGAEKITG
ELEEMRKVLEKLRALWEEEEERLRGLLRSRGAWEQQIKQLEAELSEFRMVLQRLAQEGLQ
PAAKAGTEDELVAHWRRYSATRAALASEEPRVDRLQAQLKELIVFPHNLKPLSDSVIATI
QEYQSLKVKSARLRNAAAVELWQHFQRPLQDLQLWKALAQRLLEVTASLPDLPSLHTFLP
QIEAALMESSRLKELLTMLQLKKDLLIGIFGQERATALLEQVAGSMRDRDLLHNSLLQRK
SKLQSLLAQHKDFGAAFEPLQRKLLDLQVRVQAEKGLQRDLPGKQAQLSRLQGLQEEGLD
LGAQMEAARPLVQENPNHQHKMDQLSSDFQALQRSLEDLVDRCRQSVQEHCTFSHQLLEL
RQWIVVTTQKLEAHRGEAGPGDAESQEAEFERLVAEFPEKEAQLSLVEAQGWLVMEKSSP
EGAAVVQEELRELAESWRALRLLEESLLSLIRNWHLQRMEVDSGKKMVFTNNIPKSGFLI
NPMDPIPRHRRRANLLQEEEGSHEDFSQLLRNFGQWLQVENSKLVRIIAMRTSTAEDLRT
RKSKLQELEARVPEGQHLFENLLRLGPARGTSDELEDLRYQWMLYKSKLKDSGHLLTQSS
PGEPTGFQKTRRWRGLGSLFRRACCVALPLQLLLLLFLLLLFLLPIREEDRSCTLANNFA
RSFTLMLRYNGPPPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMZ3	1.000	1.000	0.000	975	1.000	1.000	Q6ZMZ3.pdb.gz	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
2	AFDB:Q4FZC9	0.517	0.517	9.064E-86	975	0.771	0.771	Q4FZC9.pdb.gz	SYNE3_MOUSE Nesprin-3 OS=Mus musculus OX=10090 GN=Syne3 PE=1 SV=1
3	AFDB:X1WGA9	0.579	0.524	1.620E-54	1100	0.412	0.365	X1WGA9.pdb.gz	X1WGA9_DANRE Nesprin-3 OS=Danio rerio OX=7955 GN=zgc:158327 PE=1 SV=1
4	AFDB:F8WAI0	0.291	0.291	1.045E-14	975	0.163	0.163	F8WAI0.pdb.gz	F8WAI0_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
5	AFDB:Q5JV20	0.291	0.298	2.818E-14	952	0.158	0.162	Q5JV20.pdb.gz	Q5JV20_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
6	AFDB:O15020	0.222	0.105	1.169E-13	2390	0.163	0.067	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
7	AFDB:Q63128	0.191	0.196	1.425E-12	941	0.119	0.123	Q63128.pdb.gz	Q63128_RAT CPG2 protein OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
8	AFDB:Q8MRH2	0.289	0.278	2.497E-12	1025	0.162	0.154	Q8MRH2.pdb.gz	Q8MRH2_DROME LP04011p OS=Drosophila melanogaster OX=7227 GN=kst PE=2 SV=1
9	AFDB:F1QQE5	0.240	0.111	7.027E-12	2357	0.149	0.062	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
10	AFDB:P02549	0.231	0.107	7.337E-12	2419	0.134	0.054	P02549.pdb.gz	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
11	PDB:1sjjA	0.251	0.275	5.665E-4	863	0.070	0.079	1sjjA.pdb.gz
12	PDB:6nr7A	0.074	0.068	3.943E-3	1086	0.130	0.117	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
13	PDB:7r5j00	0.060	0.073	1.377E-2	756	0.121	0.156	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:1tr2B	0.074	0.071	1.501E-2	1029	0.121	0.115	1tr2B.pdb.gz
15	PDB:8a2qB	0.067	0.061	1.783E-2	1084	0.126	0.113	8a2qB.pdb.gz
16	PDB:6vaeA	0.072	0.061	2.119E-2	1198	0.124	0.101	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
17	PDB:4d1eA	0.255	0.279	2.744E-2	859	0.064	0.072	4d1eA.pdb.gz
18	PDB:4k1nA	0.085	0.136	2.744E-2	520	0.058	0.110	4k1nA.pdb.gz
19	PDB:7dkhI	0.053	0.055	2.744E-2	914	0.107	0.114	7dkhI.pdb.gz
20	PDB:6bcuA	0.062	0.034	3.123E-2	2204	0.125	0.055	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4FZC9	0.0	1451	975	0.775	0.775	SYNE3_MOUSE Nesprin-3 OS=Mus musculus OX=10090 GN=Syne3 PE=1 SV=1
2	Q6ZMZ3	0.0	1965	975	1.000	1.000	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
3	X1WGA9	0.0	566	1100	0.327	0.290	X1WGA9_DANRE Nesprin-3 OS=Danio rerio OX=7955 GN=zgc:158327 PE=1 SV=1
4	Q8NF91	4.07e-65	243	8797	0.204	0.023	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
5	A0A0C4DG40	4.14e-65	243	8749	0.204	0.023	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
6	A0A5P8DHK4	9.99e-63	236	8697	0.242	0.027	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
7	A0A8I6ABC0	9.18e-58	220	8788	0.198	0.022	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
8	A0A5P8DHN0	1.06e-57	220	8815	0.198	0.022	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
9	A0A8I5ZJB9	1.07e-57	220	8815	0.198	0.022	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
10	Q6ZWR6	6.04e-57	218	8799	0.198	0.022	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2
11	M9MRD4	4.77e-17	89.7	8382	0.155	0.018	M9MRD4_DROME Muscle-specific protein 300 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
12	M9MRD1	1.15e-16	88.2	12345	0.155	0.012	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9PC84	1.28e-16	88.2	12308	0.155	0.012	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9MRD6	1.31e-16	88.2	11999	0.155	0.013	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	M9MRF5	1.39e-16	88.2	11986	0.155	0.013	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	M9PCM8	1.63e-16	87.8	11917	0.155	0.013	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
17	Q6ZWQ0	8.29e-16	85.5	6874	0.083	0.012	SYNE2_MOUSE Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2
18	Q8WXH0	4.06e-15	83.2	6885	0.085	0.012	SYNE2_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3
19	G3V5X4	4.23e-15	83.2	6818	0.085	0.012	G3V5X4_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
20	Q8VHJ9	5.13e-07	56.6	2838	0.025	0.008	Q8VHJ9_RAT Nesprin-1 OS=Rattus norvegicus OX=10116 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10541 KASH	3.5e-21	86.4	Nuclear envelope localisation domain
2	PF18757 Nmad5	33	16.0	Nucleotide modification associated domain 5
3	PF15437 PGBA_C	1.4e+02	14.2	Plasminogen-binding protein pgbA C-terminal
4	PF00435 Spectrin	1.7e-08	46.3	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334308

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385616	0.995	SUN domain-containing protein 2
2	9606.ENSP00000384015	0.990	SUN domain-containing protein 1
3	9606.ENSP00000323856	0.989	Plectin
4	9606.ENSP00000350719	0.938	Nesprin-2
5	9606.ENSP00000356224	0.931	Nesprin-1
6	9606.ENSP00000316130	0.912	Nesprin-4
7	9606.ENSP00000297325	0.882	SUN domain-containing protein 3
8	9606.ENSP00000404220	0.863	Protein KASH5
9	9606.ENSP00000363391	0.819	Sperm-associated antigen 4 protein
10	9606.ENSP00000348496	0.790	SUN domain-containing protein 5
11	9606.ENSP00000307959	0.761	Dystonin
12	9606.ENSP00000327054	0.753	Lamin-B2
13	9606.ENSP00000354573	0.722	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
14	9606.ENSP00000358857	0.713	Emerin
15	9606.ENSP00000345719	0.703	Torsin-1A
16	9606.ENSP00000261366	0.649	Lamin-B1
17	9606.ENSP00000200181	0.645	Integrin beta-4
18	9606.ENSP00000357283	0.636	Prelamin-A/C
19	9606.ENSP00000377941	0.606	Alpha-actinin-1
20	9606.ENSP00000356584	0.571	Torsin-1A-interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0043495	0.886	protein-membrane adaptor activity
GO:0044877	0.838	protein-containing complex binding
GO:0051015	0.814	actin filament binding
GO:0140444	0.602	cytoskeleton-nuclear membrane anchor activity
GO:0019899	0.530	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051179	0.989	localization
GO:0006996	0.985	organelle organization
GO:0065007	0.975	biological regulation
GO:0050789	0.973	regulation of biological process
GO:0051641	0.972	cellular localization
GO:0033036	0.958	macromolecule localization
GO:0008104	0.952	protein localization
GO:0007010	0.950	cytoskeleton organization
GO:0051234	0.928	establishment of localization
GO:0022603	0.866	regulation of anatomical structure morphogenesis
GO:0090150	0.866	establishment of protein localization to membrane
GO:0022604	0.861	regulation of cell morphogenesis
GO:0008360	0.806	regulation of cell shape
GO:0032502	0.398	developmental process
GO:0050794	0.311	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031965	0.999	nuclear membrane
GO:0032991	0.997	protein-containing complex
GO:0098796	0.994	membrane protein complex
GO:0140513	0.994	nuclear protein-containing complex
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0005737	0.744	cytoplasm
GO:0005856	0.710	cytoskeleton
GO:0034993	0.614	meiotic nuclear membrane microtubule tethering complex
GO:0042175	0.571	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098588	0.547	bounding membrane of organelle
GO:0019867	0.505	outer membrane
GO:0005640	0.496	nuclear outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]