StarFunc result for job id Q6ZN01

User Input

>input (415 residues)
MTLAASSQRSQIIRSKFRSVLQLRIHRRNQEQISDPDPWISASDPPLAPALPSGTAPFLF
SPGVLLPEPEYCPPWRSPKKESPKISQRWRESKPRGNLTYHQYMPPEPRQGSRADPQAEG
SALGPPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSEL
RQQLRLRGLPVSGTKSMLLERMRGGAPPRERPKPRREDSPAGAPWPRLKPKALAAARRQG
SVKPSAASHRPPLPRAADTPGTAPAPTPTPAPAAAPALTPSSGPGSAALTLEEELQEAIR
RAQLLPNRGIDDILEDQVEPDDPLPPIPLDFPGSFDVLSPSPDSEGLSSVFSSSLPSPTN
SSSPSPRDPTDSLDWLEALSGGPPLGSGPPPPSIFSADLSDSSSSRLWDLLEDPW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0ZCJ7	0.209	0.207	4.943E-40	421	0.771	0.760	Q0ZCJ7.pdb.gz	MASTR_MOUSE MEF2-activating motif and SAP domain-containing transcriptional regulator OS=Mus musculus OX=10090 GN=Mamstr PE=1 SV=2
2	AFDB:Q22145	0.086	0.054	2.864E-2	718	0.111	0.064	Q22145.pdb.gz	Q22145_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-18 PE=1 SV=3
3	AFDB:Q80WT2	0.079	0.072	7.847E-2	476	0.171	0.149	Q80WT2.pdb.gz	DMRT3_MOUSE Doublesex- and mab-3-related transcription factor 3 OS=Mus musculus OX=10090 GN=Dmrt3 PE=2 SV=2
4	AFDB:Q9H4L7	0.072	0.044	2.290E-1	1026	0.137	0.056	Q9H4L7.pdb.gz	SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2
5	PDB:1zbuB	0.090	0.122	3.245E-1	304	0.022	0.030	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
6	AFDB:D6W4T8	0.098	0.045	5.534E-1	1266	0.142	0.047	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
7	AFDB:Q3TES0	0.082	0.040	5.534E-1	1195	0.186	0.064	Q3TES0.pdb.gz	IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1
8	AFDB:B2RWW0	0.094	0.067	6.277E-1	714	0.142	0.083	B2RWW0.pdb.gz	TAGAP_MOUSE T-cell activation Rho GTPase-activating protein OS=Mus musculus OX=10090 GN=Tagap PE=2 SV=2
9	AFDB:X6R4W8	0.088	0.075	7.120E-1	497	0.205	0.171	X6R4W8.pdb.gz	X6R4W8_HUMAN Zinc finger protein 207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1
10	AFDB:Q9UPP2	0.090	0.041	8.602E-1	1182	0.212	0.074	Q9UPP2.pdb.gz	IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3
11	AFDB:F5HGI6	0.071	0.049	9.161E-1	783	0.157	0.083	F5HGI6.pdb.gz	F5HGI6_CRYNB HSF-type DNA-binding domain-containing protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNBB5560 PE=3 SV=1
12	PDB:1kcfA	0.065	0.112	1.778	240	0.027	0.046	1kcfA.pdb.gz
13	PDB:1jeqA	0.077	0.059	2.017	548	0.034	0.026	1jeqA.pdb.gz
14	PDB:4v6wAN	0.054	0.106	2.595	150	0.041	0.113	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:2outA	0.075	0.210	4.034	131	0.036	0.115	2outA.pdb.gz
16	PDB:7eghA	0.080	0.053	4.034	630	0.024	0.016	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:3j7aU	0.043	0.103	4.873	149	0.041	0.114	3j7aU.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:1qhaA	0.070	0.035	7.112	903	0.024	0.011	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.
19	PDB:3s5wB	0.050	0.050	7.112	414	0.022	0.022	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
20	PDB:7aqqd	0.062	0.226	7.112	75	0.014	0.080	7aqqd.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0ZCJ7	5.77e-157	451	421	0.766	0.755	MASTR_MOUSE MEF2-activating motif and SAP domain-containing transcriptional regulator OS=Mus musculus OX=10090 GN=Mamstr PE=1 SV=2
2	Q8IZQ8	5.83e-07	54.3	938	0.055	0.025	MYCD_HUMAN Myocardin OS=Homo sapiens OX=9606 GN=MYOCD PE=1 SV=1
3	Q8VIM5	8.85e-07	53.5	935	0.055	0.025	MYCD_MOUSE Myocardin OS=Mus musculus OX=10090 GN=Myocd PE=1 SV=2
4	Q8R5I7	1.02e-06	53.5	938	0.055	0.025	MYCD_RAT Myocardin OS=Rattus norvegicus OX=10116 GN=Myocd PE=1 SV=2
5	Q9ULH7	1.03e-04	47.0	1088	0.096	0.037	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
6	A0A8I5Y983	1.05e-04	47.0	879	0.046	0.022	A0A8I5Y983_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
7	A0A8I5ZKI6	1.22e-04	47.0	901	0.046	0.021	A0A8I5ZKI6_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
8	F1LVR8	1.25e-04	46.6	908	0.046	0.021	F1LVR8_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
9	A0A087WU73	1.33e-04	46.6	882	0.046	0.022	A0A087WU73_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
10	A0A8I6GFP9	1.37e-04	46.6	938	0.046	0.020	A0A8I6GFP9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
11	A0A8I5Y4Q9	1.39e-04	46.6	993	0.046	0.019	A0A8I5Y4Q9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
12	Q969V6	1.43e-04	46.6	931	0.046	0.020	MRTFA_HUMAN Myocardin-related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
13	A0A8I6AI47	1.44e-04	46.6	992	0.046	0.019	A0A8I6AI47_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
14	A4FUJ8	1.45e-04	46.6	798	0.046	0.024	A4FUJ8_HUMAN MKL1 protein OS=Homo sapiens OX=9606 GN=MKL1 PE=1 SV=1
15	A0A0G2K3Y9	1.46e-04	46.6	1028	0.046	0.018	A0A0G2K3Y9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=4 SV=2
16	A0A0G2JXC5	1.48e-04	46.6	1038	0.046	0.018	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
17	A0A087X287	1.49e-04	46.6	799	0.046	0.024	A0A087X287_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
18	F1LV40	1.49e-04	46.6	963	0.046	0.020	F1LV40_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
19	Q8K4J6	1.49e-04	46.6	964	0.046	0.020	MRTFA_MOUSE Myocardin-related transcription factor A OS=Mus musculus OX=10090 GN=Mrtfa PE=1 SV=2
20	A0A8I5Y2C3	1.50e-04	46.6	978	0.046	0.019	A0A8I5Y2C3_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02037 SAP	3.5e-05	34.7	SAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324175

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228644	0.650	Myogenic factor 5
2	9606.ENSP00000340874	0.605	Myocyte-specific enhancer factor 2C
3	9606.ENSP00000339086	0.507	MKL/myocardin-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.450	organic cyclic compound binding
GO:1901363	0.447	heterocyclic compound binding
GO:0003676	0.444	nucleic acid binding
GO:0003677	0.309	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.993	regulation of primary metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0009889	0.985	regulation of biosynthetic process
GO:0045944	0.978	positive regulation of transcription by RNA polymerase II
GO:0051094	0.972	positive regulation of developmental process
GO:0045597	0.964	positive regulation of cell differentiation
GO:0051147	0.878	regulation of muscle cell differentiation
GO:0051149	0.656	positive regulation of muscle cell differentiation
GO:0051155	0.510	positive regulation of striated muscle cell differentiation
GO:0009987	0.462	cellular process
GO:0048519	0.354	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.834	cytoplasm
GO:0005829	0.664	cytosol
GO:0043232	0.393	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]