StarFunc result for job id Q6ZN08

User Input

>input (573 residues)
MGPLQFRDVAIEFSLEEWHCLDMAQRNLYRDVMLENYRNLVFLGIVVSKPDLITHLEQGK
KPSTMQRHEMVANPSVLCSHFNQDLWPEQSIKDSFQKLILRRHKKCGHDNLQLKKGCESV
DKCKVHKRGYNGLNQCLTTTQSKMFQCDKHGKVFHQFSNTNRHKIRHTGKNPCKFTECGK
AFNRSSTFTTHKKIHTGEKPYKCIECGKAFNRSSHLTTHKIIHTGEKRYKCEDCGKAFNR
SSNLTTHKKIHTGEKPYKCEECGKAFKRSSILTTHKRIHTGEKPYKCEECGKVFKYLSSL
STHKIIHTGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGKGFKYSSTLTKHK
IIHTGEKPYKCEECGEAFKYSCSLTAHKIIHTGKKPYKCEECGKVFKHSSPLSKHKRIHT
GEKPYKCEECGKAFSRSSILTTHKIIHTGEKPYECEDCGKAFNRSSNLTKHKKIHTGEKP
YKCEECGKAFKCSSILTTHKRIHTADKPYKCEECGKDFKYSSTLTRHKKIHTGGKPHKCN
KCGKAFISSSNLSRHEIIHMGGNPYKCENVAKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35789	0.625	0.585	1.036E-73	620	0.752	0.695	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
2	AFDB:Q03923	0.608	0.589	8.165E-72	595	0.735	0.708	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
3	AFDB:A6NNF4	0.626	0.495	1.572E-71	738	0.723	0.561	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q05481	0.409	0.223	1.161E-68	1191	0.707	0.340	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	AFDB:Q03936	0.524	0.514	1.579E-66	586	0.712	0.696	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
6	AFDB:Q8TD23	0.475	0.479	3.392E-66	568	0.691	0.697	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
7	AFDB:O75437	0.553	0.489	2.055E-65	659	0.726	0.631	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
8	AFDB:Q14593	0.280	0.281	9.473E-65	569	0.672	0.677	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	AFDB:Q8IYB9	0.566	0.509	7.962E-64	648	0.639	0.565	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
10	AFDB:P17038	0.316	0.234	2.127E-63	809	0.733	0.519	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
11	PDB:3w5kB	0.091	0.300	4.818E-4	110	0.065	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7kpvC	0.060	0.068	2.156	487	0.112	0.131	7kpvC.pdb.gz
13	PDB:7kpxC	0.063	0.038	2.277	1352	0.098	0.041	7kpxC.pdb.gz
14	PDB:7ajuCK	0.064	0.140	2.540	222	0.049	0.126	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:5gm6P	0.053	0.107	2.682	246	0.051	0.118	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7ktsD	0.062	0.116	2.682	219	0.047	0.123	7ktsD.pdb.gz
17	PDB:7mqaSI	0.083	0.062	2.833	803	0.038	0.027	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6vk0C	0.059	0.142	3.160	180	0.033	0.106	6vk0C.pdb.gz
19	PDB:3j9qA	0.053	0.074	3.722	385	0.026	0.039	3j9qA.pdb.gz
20	PDB:5c8dE	0.066	0.103	3.931	280	0.028	0.057	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	526	609	0.497	0.468	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A6NNF4	539	616	0.483	0.450	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
3	O75290	538	641	0.480	0.429	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
4	O75437	564	659	0.518	0.451	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
5	P17038	557	809	0.524	0.371	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
6	P35789	871	620	0.778	0.719	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	P52742	527	658	0.510	0.444	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
8	Q03923	833	595	0.735	0.708	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	Q03936	786	586	0.707	0.691	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
10	Q05481	553	1191	0.510	0.245	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
11	Q14593	755	569	0.663	0.668	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
12	Q15928	588	474	0.538	0.650	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
13	Q2NKJ9	736	569	0.647	0.652	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
14	Q49A12	703	536	0.628	0.672	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
15	Q5JVG8	644	444	0.551	0.712	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
16	Q6ZR52	536	646	0.506	0.449	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
17	Q76KX8	553	674	0.527	0.448	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
18	Q8IW36	576	515	0.529	0.588	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
19	Q8IYB9	535	648	0.480	0.424	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
20	Q8IYN0	708	542	0.630	0.666	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	3.6e+02	12.8	TFIIH C1-like domain
2	PF07754 HVO_2753_ZBP	2.5e+02	12.9	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF01352 KRAB	2e-19	80.2	KRAB box
4	PF01286 XPA_N	1.3e-16	71.6	XPA protein N-terminal
5	PF01428 zf-AN1	75	14.9	AN1-like Zinc finger
6	PF00096 zf-C2H2	8.7e-66	226.0	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	3.8e-07	41.1	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	1.7e-38	139.0	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	1.2e-17	74.7	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	2e-19	80.6	Zinc-finger double-stranded RNA-binding
11	PF13465 zf-H2C2_2	2.4e-109	364.6	Zinc-finger double domain
12	PF02591 zf-RING_7	0.0097	27.4	C4-type zinc ribbon domain
13	PF13451 zf-trcl	0.0055	27.9	Probable zinc-ribbon domain
14	PF18439 zf_UBZ	1.2e-08	45.7	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	0.43	22.7	zinc-ribbon family
16	PF09723 Zn-ribbon_8	4.4e-12	57.2	Zinc ribbon domain
17	PF17283 Zn_ribbon_SprT	8e-06	37.1	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000461425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446099	0.559	RNA binding motif protein, X-linked-like-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031323	0.997	regulation of cellular metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0051252	0.985	regulation of RNA metabolic process
GO:0009889	0.953	regulation of biosynthetic process
GO:0009987	0.787	cellular process
GO:0048519	0.779	negative regulation of biological process
GO:0031326	0.759	regulation of cellular biosynthetic process
GO:0010556	0.752	regulation of macromolecule biosynthetic process
GO:0009892	0.743	negative regulation of metabolic process
GO:0031324	0.728	negative regulation of cellular metabolic process
GO:0051172	0.727	negative regulation of nitrogen compound metabolic process
GO:0009890	0.716	negative regulation of biosynthetic process
GO:0010605	0.708	negative regulation of macromolecule metabolic process
GO:2001141	0.681	regulation of RNA biosynthetic process
GO:0010558	0.646	negative regulation of macromolecule biosynthetic process
GO:0031327	0.645	negative regulation of cellular biosynthetic process
GO:0045934	0.605	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.549	regulation of DNA-templated transcription
GO:0051253	0.485	negative regulation of RNA metabolic process
GO:0071704	0.422	organic substance metabolic process
GO:1902679	0.416	negative regulation of RNA biosynthetic process
GO:1903507	0.393	negative regulation of nucleic acid-templated transcription
GO:0044237	0.387	cellular metabolic process
GO:0045892	0.380	negative regulation of DNA-templated transcription
GO:1901360	0.365	organic cyclic compound metabolic process
GO:0006725	0.335	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0031981	0.978	nuclear lumen
GO:0005654	0.970	nucleoplasm
GO:0005737	0.545	cytoplasm
GO:0032991	0.374	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]