StarFunc result for job id Q6ZN16

User Input

>input (1313 residues)
MESGGGNAPAGALGAASESPQCPPPPGVEGAAGPAEPDGAAEGAAGGSGEGESGGGPRRA
LRAVYVRSESSQGGAAGGPEAGARQCLLRACEAEGAHLTSVPFGELDFGETAVLDAFYDA
DVAVVDMSDVSRQPSLFYHLGVRESFDMANNVILYHDTDADTALSLKDMVTQKNTASSGN
YYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLCMPLVDRFISLLKDIHVTSC
VYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDA
MVKLVETLEMLPTCDLADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQSCDHPGPDM
FCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETS
LELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVW
YLRSLVQNLLLIRRFKKTIIEHSPRQERLNFWLDIIFEATNEVTNGLRFPVLVIEPTKVY
QPSYVSINNEAEERTVSLWHVSPTEMKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNS
DDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGETDGDTLEYEYDHDANGERVVLGK
GTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENG
YIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVL
VNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCT
IIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTA
ELLREGFLRQVNKGKKNRIAFKPSEGPRGVVLALPTQGEPMATSSSEHGSVSPDSDAQPD
ALFERTRAPRHHLGHLLSVPDESSALEDRGLASSPEDRDQGLFLLRKDSERRAILYKILW
EEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRVMATTISKLKVDLDF
DSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILIPELRAHFE
PTCETEGVDKDMDEAEEGYPPATGPGQEAQPHQQHLSLQLGELRQETNRLLEHLVEKERE
YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEK
IVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKDKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZH6	0.517	0.494	0.000	1379	0.588	0.560	D3ZZH6.pdb.gz	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
2	AFDB:O95382	0.596	0.607	0.000	1288	0.445	0.453	O95382.pdb.gz	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
3	AFDB:Q9WTR2	0.580	0.589	0.000	1291	0.442	0.449	Q9WTR2.pdb.gz	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
4	AFDB:Q9VDS9	0.476	0.460	1.359E-100	1363	0.419	0.404	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
5	AFDB:Q21029	0.455	0.403	7.267E-96	1498	0.401	0.351	Q21029.pdb.gz	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
6	AFDB:Q54R82	0.199	0.276	9.063E-23	942	0.107	0.149	Q54R82.pdb.gz	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
7	AFDB:Q9FZ36	0.191	0.371	4.482E-22	651	0.117	0.237	Q9FZ36.pdb.gz	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
8	AFDB:O22040	0.194	0.369	8.568E-22	666	0.124	0.245	O22040.pdb.gz	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
9	AFDB:Q40541	0.193	0.358	4.620E-21	690	0.112	0.213	Q40541.pdb.gz	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
10	AFDB:O14299	0.191	0.179	5.491E-21	1401	0.139	0.130	O14299.pdb.gz	WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wis4 PE=3 SV=1
11	PDB:5ufuA	0.177	0.602	4.141E-15	369	0.054	0.192	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
12	PDB:4eomC	0.185	0.807	8.631E-15	276	0.060	0.286	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:5u6yA	0.184	0.505	1.118E-14	459	0.065	0.185	5u6yA.pdb.gz
14	PDB:4zhxA	0.181	0.558	1.168E-14	409	0.056	0.178	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:4krcA	0.180	0.748	2.048E-14	297	0.061	0.269	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4yc3A	0.183	0.756	2.048E-14	295	0.057	0.254	4yc3A.pdb.gz
17	PDB:6b1uA	0.177	0.509	2.654E-14	442	0.055	0.163	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:3eqdA	0.176	0.679	3.154E-14	315	0.063	0.263	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:6byrA	0.188	0.581	5.073E-14	405	0.060	0.195	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
20	PDB:5dykA	0.181	0.289	6.030E-14	809	0.063	0.103	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A280	0.0	1512	1373	0.585	0.559	A0A8I6A280_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
2	A0A8I6AEL0	0.0	1528	1381	0.588	0.559	A0A8I6AEL0_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
3	D3ZW27	0.0	1429	1365	0.564	0.542	D3ZW27_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
4	D3ZZH6	0.0	1529	1381	0.588	0.559	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
5	O35099	0.0	1526	1380	0.589	0.561	M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map3k5 PE=1 SV=3
6	O95382	0.0	1078	1288	0.439	0.448	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
7	Q21029	0.0	840	1498	0.398	0.349	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
8	Q24458	0.0	566	650	0.231	0.466	Q24458_DROME Protein kinase OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=2 SV=1
9	Q99683	0.0	1544	1374	0.593	0.567	M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1
10	Q9WTR2	0.0	1071	1291	0.451	0.459	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
11	Q40541	2.92e-60	223	690	0.091	0.172	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
12	O22040	1.96e-58	216	666	0.086	0.170	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
13	O22042	2.77e-58	216	651	0.091	0.184	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
14	Q9FZ36	5.92e-57	212	651	0.086	0.174	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
15	Q54R82	1.11e-55	213	942	0.083	0.116	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
16	F4HRJ4	5.66e-51	193	609	0.085	0.184	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
17	Q9CAD5	2.08e-49	192	883	0.088	0.130	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
18	Q39008	2.61e-49	188	608	0.082	0.178	M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2
19	Q389U2	4.62e-49	187	606	0.091	0.196	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
20	Q6FXI1	7.91e-49	188	676	0.081	0.158	Q6FXI1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE11 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	8.4e+02	11.2	Phosphotransferase enzyme family
2	PF19039 ASK_PH	3.5e-39	144.6	ASK kinase PH domain
3	PF20309 DRHyd-ASK	8.8e-12	56.1	Deoxyribohydrolase (DRHyd) domain of the ASK signalosome
4	PF04772 Flu_B_M2	3.4e+02	12.9	Influenza B matrix protein 2 (BM2)
5	PF20302 HisK-N-like	7.2e-42	154.2	HisK-N-like globin domain of the ASK signalosome
6	PF14531 Kinase-like	1.1	20.1	Kinase-like
7	PF13281 MAP3K_TRAF_bd	6.9e-160	543.8	MAP3K TRAFs-binding domain
8	PF00069 Pkinase	2.5e-61	219.0	Protein kinase domain
9	PF17667 Pkinase_fungal	15	15.8	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	2.5e-38	143.4	Protein tyrosine and serine/threonine kinase
11	PF13543 SAM_KSR1	55	15.3	SAM like domain present in kinase suppressor RAS 1
12	PF09111 SLIDE	2.7e+02	13.0	SLIDE
13	PF20308 TPR-S	4.3e-23	93.2	Tetratricopeptide Repeats-Sensor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259371	0.741	Disabled homolog 2-interacting protein
2	9606.ENSP00000356621	0.741	Ras GTPase-activating protein nGAP
3	9606.ENSP00000369372	0.720	BEN domain containing 2
4	9606.ENSP00000451828	0.712	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000263826	0.710	RAC-gamma serine/threonine-protein kinase
6	9606.ENSP00000375892	0.710	RAC-beta serine/threonine-protein kinase
7	9606.ENSP00000335153	0.673	Heat shock protein HSP 90-alpha
8	9606.ENSP00000360609	0.673	Heat shock protein HSP 90-beta
9	9606.ENSP00000380921	0.673	SH3 domain-containing kinase-binding protein 1
10	9606.ENSP00000403636	0.669	Ras/Rap GTPase-activating protein SynGAP
11	9606.ENSP00000444210	0.659	Retinoic acid induced 2
12	9606.ENSP00000258034	0.642	Trace amine-associated receptor 5
13	9606.ENSP00000366243	0.619	Cell surface hyaluronidase
14	9606.ENSP00000481850	0.616	Protein Jade-3
15	9606.ENSP00000328307	0.612	Protein FAM47B
16	9606.ENSP00000370519	0.608	Arylsulfatase F
17	9606.ENSP00000272542	0.602	Sodium-dependent phosphate transporter 1
18	9606.ENSP00000378177	0.599	Cell migration-inducing and hyaluronan-binding protein
19	9606.ENSP00000395538	0.590	Trinucleotide repeat-containing gene 18 protein
20	9606.ENSP00000395220	0.578	Synaptotagmin-like protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004709	0.999	MAP kinase kinase kinase activity
GO:1901363	0.938	heterocyclic compound binding
GO:0097159	0.938	organic cyclic compound binding
GO:0043168	0.925	anion binding
GO:0097367	0.918	carbohydrate derivative binding
GO:0005524	0.866	ATP binding
GO:0019899	0.745	enzyme binding
GO:0019901	0.446	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010941	0.991	regulation of cell death
GO:0051403	0.990	stress-activated MAPK cascade
GO:0043410	0.988	positive regulation of MAPK cascade
GO:0043405	0.986	regulation of MAP kinase activity
GO:0010942	0.982	positive regulation of cell death
GO:0007254	0.981	JNK cascade
GO:0043506	0.980	regulation of JUN kinase activity
GO:0042221	0.979	response to chemical
GO:0043406	0.979	positive regulation of MAP kinase activity
GO:0070302	0.978	regulation of stress-activated protein kinase signaling cascade
GO:0008219	0.972	cell death
GO:0043065	0.966	positive regulation of apoptotic process
GO:0070304	0.965	positive regulation of stress-activated protein kinase signaling cascade
GO:0043507	0.963	positive regulation of JUN kinase activity
GO:0034599	0.948	cellular response to oxidative stress
GO:0010033	0.945	response to organic substance
GO:0042542	0.943	response to hydrogen peroxide
GO:0070301	0.931	cellular response to hydrogen peroxide
GO:0032874	0.899	positive regulation of stress-activated MAPK cascade
GO:0048660	0.869	regulation of smooth muscle cell proliferation
GO:0034612	0.865	response to tumor necrosis factor
GO:1904019	0.830	epithelial cell apoptotic process
GO:0010660	0.783	regulation of muscle cell apoptotic process
GO:0034976	0.720	response to endoplasmic reticulum stress
GO:0008284	0.686	positive regulation of cell population proliferation
GO:0071704	0.638	organic substance metabolic process
GO:0044238	0.603	primary metabolic process
GO:0071310	0.603	cellular response to organic substance
GO:0006807	0.600	nitrogen compound metabolic process
GO:0043170	0.559	macromolecule metabolic process
GO:1901564	0.547	organonitrogen compound metabolic process
GO:0009611	0.529	response to wounding
GO:0044237	0.519	cellular metabolic process
GO:0019538	0.408	protein metabolic process
GO:0036211	0.356	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005886	0.992	plasma membrane
GO:0009986	0.944	cell surface
GO:0098552	0.724	side of membrane
GO:0043226	0.703	organelle
GO:0009897	0.630	external side of plasma membrane
GO:0043227	0.628	membrane-bounded organelle
GO:0043229	0.574	intracellular organelle
GO:0043231	0.563	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	0.999	mitogen-activated protein kinase kinase kinase.

[back to server]