StarFunc result for job id Q6ZN17

User Input

>input (250 residues)
MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQ
KRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQ
EAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKK
GPSVQKRKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GVD3	0.539	0.525	7.030E-41	258	0.992	0.961	A0A1B0GVD3.pdb.gz	A0A1B0GVD3_HUMAN Lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
2	AFDB:S0BDM9	0.491	0.567	3.467E-27	213	0.564	0.662	S0BDM9.pdb.gz	S0BDM9_DANRE Lin-28 homolog protein OS=Danio rerio OX=7955 GN=lin28b PE=2 SV=1
3	AFDB:Q803L0	0.483	0.583	2.762E-26	202	0.488	0.604	Q803L0.pdb.gz	LN28A_DANRE Protein lin-28 homolog A OS=Danio rerio OX=7955 GN=lin28a PE=1 SV=1
4	AFDB:Q8K3Y3	0.380	0.453	2.762E-26	209	0.516	0.617	Q8K3Y3.pdb.gz	LN28A_MOUSE Protein lin-28 homolog A OS=Mus musculus OX=10090 GN=Lin28a PE=1 SV=1
5	AFDB:Q9VRN5	0.316	0.401	6.342E-18	195	0.316	0.405	Q9VRN5.pdb.gz	LIN28_DROME Protein lin-28 homolog OS=Drosophila melanogaster OX=7227 GN=lin-28 PE=2 SV=2
6	AFDB:B5DE31	0.320	0.264	7.725E-10	310	0.244	0.197	B5DE31.pdb.gz	YBOX1_DANRE Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1
7	AFDB:O46173	0.314	0.223	8.183E-10	359	0.244	0.170	O46173.pdb.gz	O46173_DROME Y-box protein OS=Drosophila melanogaster OX=7227 GN=yps PE=2 SV=1
8	AFDB:A0A024RAQ1	0.318	0.225	1.731E-9	372	0.244	0.164	A0A024RAQ1.pdb.gz
9	AFDB:Q95RE4	0.311	0.226	2.180E-9	352	0.256	0.182	Q95RE4.pdb.gz	Q95RE4_DROME LD37574p OS=Drosophila melanogaster OX=7227 GN=yps PE=1 SV=1
10	AFDB:P21574	0.305	0.230	2.447E-9	336	0.276	0.205	P21574.pdb.gz	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
11	PDB:2l15A	0.262	0.900	4.020E-6	70	0.124	0.443	2l15A.pdb.gz
12	PDB:1zeqX	0.234	0.584	1.138E-4	84	0.052	0.155	1zeqX.pdb.gz
13	PDB:2lxjA	0.236	0.834	7.625E-4	66	0.112	0.424	2lxjA.pdb.gz
14	PDB:3aqqA	0.228	0.517	9.065E-4	99	0.100	0.253	3aqqA.pdb.gz
15	PDB:1bbuA	0.246	0.139	1.438E-3	486	0.048	0.025	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
16	PDB:6d6qI	0.244	0.326	2.415E-3	183	0.052	0.071	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
17	PDB:1e1tA	0.230	0.128	7.220E-3	485	0.040	0.021	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
18	PDB:1u5kA	0.228	0.235	1.081E-2	242	0.032	0.033	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
19	PDB:3kf6B	0.210	0.439	1.285E-2	105	0.056	0.133	3kf6B.pdb.gz
20	PDB:8d0bC	0.225	0.420	1.714E-2	121	0.048	0.099	8d0bC.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GVD3	0.0	501	258	0.992	0.961	A0A1B0GVD3_HUMAN Lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
2	Q6ZN17	0.0	505	250	1.000	1.000	LN28B_HUMAN Protein lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
3	Q9H9Z2	3.07e-85	254	209	0.492	0.589	LN28A_HUMAN Protein lin-28 homolog A OS=Homo sapiens OX=9606 GN=LIN28A PE=1 SV=1
4	Q8K3Y3	5.19e-85	254	209	0.492	0.589	LN28A_MOUSE Protein lin-28 homolog A OS=Mus musculus OX=10090 GN=Lin28a PE=1 SV=1
5	S0BDM9	8.94e-81	243	213	0.512	0.601	S0BDM9_DANRE Lin-28 homolog protein OS=Danio rerio OX=7955 GN=lin28b PE=2 SV=1
6	Q803L0	2.54e-77	234	202	0.448	0.554	LN28A_DANRE Protein lin-28 homolog A OS=Danio rerio OX=7955 GN=lin28a PE=1 SV=1
7	Q9VRN5	6.87e-34	122	195	0.296	0.379	LIN28_DROME Protein lin-28 homolog OS=Drosophila melanogaster OX=7227 GN=lin-28 PE=2 SV=2
8	P92186	3.88e-18	82.4	227	0.236	0.260	LIN28_CAEEL Protein lin-28 OS=Caenorhabditis elegans OX=6239 GN=lin-28 PE=1 SV=1
9	O65639	4.00e-18	83.6	299	0.216	0.181	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
10	P62960	2.59e-14	73.2	322	0.156	0.121	YBOX1_MOUSE Y-box-binding protein 1 OS=Mus musculus OX=10090 GN=Ybx1 PE=1 SV=3
11	P62961	2.59e-14	73.2	322	0.156	0.121	YBOX1_RAT Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3
12	P67809	2.65e-14	73.2	324	0.156	0.120	YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
13	P21574	2.86e-14	73.2	336	0.156	0.116	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
14	O62213	4.89e-14	70.9	208	0.156	0.188	O62213_CAEEL CSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cey-1 PE=1 SV=1
15	A0A8I5ZJP8	6.89e-14	71.6	282	0.172	0.152	A0A8I5ZJP8_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=4 SV=1
16	D4A3P0	7.12e-14	72.4	359	0.172	0.120	D4A3P0_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=1 SV=1
17	B5DE31	1.08e-13	71.2	310	0.156	0.126	YBOX1_DANRE Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1
18	P45441	1.08e-13	71.6	324	0.156	0.120	YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2
19	Q94C69	1.71e-13	70.9	301	0.196	0.163	CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=CSP3 PE=1 SV=1
20	Q9JKB3	2.04e-13	70.9	361	0.188	0.130	YBOX3_MOUSE Y-box-binding protein 3 OS=Mus musculus OX=10090 GN=Ybx3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00313 CSD	2.6e-13	60.9	'Cold-shock' DNA-binding domain
2	PF00098 zf-CCHC	2.3e-05	35.4	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257177	0.959	Terminal uridylyltransferase 4
2	9606.ENSP00000373272	0.888	E3 ubiquitin-protein ligase TRIM71
3	9606.ENSP00000315569	0.847	DIS3-like exonuclease 2
4	9606.ENSP00000323588	0.836	Transcription factor SOX-2
5	9606.ENSP00000437256	0.813	Endoribonuclease Dicer
6	9606.ENSP00000425979	0.797	Ribonuclease 3
7	9606.ENSP00000437621	0.758	High mobility group protein HMGI-C
8	9606.ENSP00000344666	0.700	Merlin
9	9606.ENSP00000290341	0.699	Insulin-like growth factor 2 mRNA-binding protein 1
10	9606.ENSP00000263209	0.691	Microprocessor complex subunit DGCR8
11	9606.ENSP00000365130	0.673	Terminal uridylyltransferase 7
12	9606.ENSP00000339250	0.659	Developmental pluripotency-associated protein 3
13	9606.ENSP00000479618	0.653	Myc proto-oncogene protein
14	9606.ENSP00000261654	0.648	Adhesion G-protein coupled receptor D1
15	9606.ENSP00000356581	0.645	Adhesion G-protein coupled receptor G6
16	9606.ENSP00000256190	0.642	Myotubularin-related protein 13
17	9606.ENSP00000259915	0.625	POU domain, class 5, transcription factor 1
18	9606.ENSP00000308000	0.619	Speckle targeted PIP5K1A-regulated poly(A) polymerase
19	9606.ENSP00000310275	0.611	Barrier-to-autointegration factor
20	9606.ENSP00000265074	0.604	Atrial natriuretic peptide receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003690	0.997	double-stranded DNA binding
GO:0043565	0.995	sequence-specific DNA binding
GO:0003729	0.912	mRNA binding
GO:1990837	0.633	sequence-specific double-stranded DNA binding
GO:0061980	0.332	regulatory RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0010629	0.995	negative regulation of gene expression
GO:0090304	0.995	nucleic acid metabolic process
GO:0016070	0.994	RNA metabolic process
GO:0080090	0.993	regulation of primary metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0009893	0.986	positive regulation of metabolic process
GO:0031047	0.985	RNA-mediated gene silencing
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0035196	0.975	miRNA processing
GO:0034655	0.974	nucleobase-containing compound catabolic process
GO:0051172	0.952	negative regulation of nitrogen compound metabolic process
GO:0048522	0.950	positive regulation of cellular process
GO:0044260	0.946	cellular macromolecule metabolic process
GO:0051173	0.943	positive regulation of nitrogen compound metabolic process
GO:0031325	0.943	positive regulation of cellular metabolic process
GO:0031324	0.940	negative regulation of cellular metabolic process
GO:0051252	0.909	regulation of RNA metabolic process
GO:0009894	0.907	regulation of catabolic process
GO:0034661	0.903	ncRNA catabolic process
GO:0060147	0.896	regulation of post-transcriptional gene silencing
GO:0010608	0.896	post-transcriptional regulation of gene expression
GO:0060966	0.895	regulation of gene silencing by RNA
GO:0010628	0.846	positive regulation of gene expression
GO:0031329	0.838	regulation of cellular catabolic process
GO:0045935	0.838	positive regulation of nucleobase-containing compound metabolic process
GO:2000628	0.834	regulation of miRNA metabolic process
GO:0031123	0.810	RNA 3'-end processing
GO:0051254	0.804	positive regulation of RNA metabolic process
GO:1900368	0.785	regulation of post-transcriptional gene silencing by RNA
GO:2000630	0.741	positive regulation of miRNA metabolic process
GO:0060964	0.733	regulation of miRNA-mediated gene silencing
GO:0032502	0.690	developmental process
GO:0032501	0.601	multicellular organismal process
GO:0065008	0.579	regulation of biological quality
GO:0043487	0.516	regulation of RNA stability
GO:0031326	0.502	regulation of cellular biosynthetic process
GO:0070920	0.490	regulation of production of small RNA involved in gene silencing by RNA
GO:0010556	0.473	regulation of macromolecule biosynthetic process
GO:0031331	0.457	positive regulation of cellular catabolic process
GO:0045934	0.366	negative regulation of nucleobase-containing compound metabolic process
GO:0048856	0.349	anatomical structure development
GO:0051246	0.319	regulation of protein metabolic process
GO:0051253	0.316	negative regulation of RNA metabolic process
GO:0050896	0.306	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0005730	0.994	nucleolus
GO:0032991	0.379	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]