StarFunc result for job id Q6ZN28

User Input

>input (852 residues)
MLITERKHFRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNA
SKVANPFWNQLSASNPFLDDITQLRNNRKRNNISILKEDPFLFCREIENGNSFDSSGDEL
DVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKM
AWLSQRQLARSCLDLNTISQSPGWAQTQLAEVTIACKVNHQGGSVQLPESDITVHVPQGH
VAVGEFQEVSLRAFLDPPHMLNHDLSCTVSPLLEIMLGNLNTMEALLLEMKIGAEVRKDP
FSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAAQAKALPSPAA
TIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNISPVVFQLW
GKQSFLLDKPQDLSISIFSCDPDFEVKTEGERKEIKQKQLEAGEVVHQQFLFSLVEHREM
HLFDFCVQVEPPNGEPVAQFSITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKY
PTFQDKTLNFSNYGVTLKAVLRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVG
VLRGKIGLVHCKNVKVISKEQVMFMSDSVFTTRNLLEQIVLPLKKLTYIYSVVLTLVSEK
VYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKLKEDCHTERNTRKFLYELIVA
LLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEIPHRGNTGDVA
VEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEV
LRVTAFSTSEEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZN28	1.000	1.000	0.000	852	1.000	1.000	Q6ZN28.pdb.gz	MACC1_HUMAN Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2
2	AFDB:A0A2R8PZH9	0.589	0.586	3.796E-93	858	0.452	0.449	A0A2R8PZH9.pdb.gz
3	AFDB:Q9P0V3	0.504	0.457	4.536E-84	963	0.404	0.357	Q9P0V3.pdb.gz	SH3B4_HUMAN SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1
4	AFDB:Q8K1S2	0.259	0.233	1.213E-14	956	0.066	0.059	Q8K1S2.pdb.gz	UNC5D_MOUSE Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1
5	AFDB:A0A0R4IE04	0.243	0.223	3.441E-14	940	0.099	0.089	A0A0R4IE04.pdb.gz
6	AFDB:Q95TU8	0.244	0.200	7.008E-12	1072	0.113	0.090	Q95TU8.pdb.gz	UNC5_DROME Netrin receptor unc-5 OS=Drosophila melanogaster OX=7227 GN=unc-5 PE=1 SV=1
7	AFDB:A1ZBD6	0.067	0.064	3.549E-6	912	0.127	0.118	A1ZBD6.pdb.gz	MCTP_DROME Multiple C2 and transmembrane domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Mctp PE=1 SV=3
8	PDB:7crwA	0.195	0.477	9.130E-6	279	0.041	0.125	7crwA.pdb.gz
9	AFDB:Q56VX4	0.117	0.091	8.096E-5	1124	0.059	0.044	Q56VX4.pdb.gz	Q56VX4_CAEEL Tight junction protein ZO-1 OS=Caenorhabditis elegans OX=6239 GN=zoo-1 PE=1 SV=2
10	PDB:7jkqB	0.216	0.544	8.588E-5	272	0.032	0.099	7jkqB.pdb.gz
11	AFDB:O97758	0.127	0.064	1.228E-4	1769	0.060	0.029	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
12	AFDB:A0A494C1M0	0.071	0.061	3.307E-4	1011	0.076	0.064	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
13	PDB:6xt9I	0.092	0.101	2.291E-3	767	0.097	0.108	6xt9I.pdb.gz
14	PDB:2dybA	0.064	0.177	7.211E-3	298	0.021	0.060	2dybA.pdb.gz
15	PDB:5c0xC	0.068	0.127	7.597E-3	339	0.035	0.088	5c0xC.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
16	PDB:2fuqA	0.073	0.079	8.883E-3	747	0.034	0.039	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
17	PDB:2lqnA	0.066	0.175	1.039E-2	303	0.025	0.069	2lqnA.pdb.gz
18	PDB:1griA	0.066	0.254	2.519E-2	211	0.033	0.133	1griA.pdb.gz
19	PDB:3qwyA	0.060	0.276	2.519E-2	170	0.026	0.129	3qwyA.pdb.gz
20	PDB:3s3sA	0.088	0.115	3.823E-2	620	0.029	0.040	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FG38	0.0	780	853	0.458	0.457	E7FG38_DANRE MET transcriptional regulator MACC1 OS=Danio rerio OX=7955 GN=macc1 PE=4 SV=1
2	Q6ZN28	0.0	1771	852	1.000	1.000	MACC1_HUMAN Metastasis-associated in colon cancer protein 1 OS=Homo sapiens OX=9606 GN=MACC1 PE=1 SV=2
3	Q9P0V3	0.0	652	963	0.424	0.375	SH3B4_HUMAN SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1
4	Q8IV45	1.8	34.7	518	0.018	0.029	UN5CL_HUMAN UNC5C-like protein OS=Homo sapiens OX=9606 GN=UNC5CL PE=1 SV=2
5	A0A1D8PG20	5.9	32.7	491	0.031	0.053	A0A1D8PG20_CANAL Bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO8 PE=4 SV=1
6	Q9JLT0	6.0	33.1	1976	0.034	0.015	MYH10_RAT Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=1
7	Q8CJ26	6.6	32.3	228	0.036	0.136	NRADD_MOUSE Death domain-containing membrane protein NRADD OS=Mus musculus OX=10090 GN=Nradd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	32	16.1	Death domain
2	PF07653 SH3_2	2.7	19.2	Variant SH3 domain
3	PF10671 TcpQ	72	14.8	Toxin co-regulated pilus biosynthesis protein Q
4	PF00791 ZU5	5.8	18.5	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384234	0.723	Transmembrane protein 196
2	9606.ENSP00000222584	0.702	Transcription factor Sp4
3	9606.ENSP00000401597	0.676	Death domain containing 1
4	9606.ENSP00000317272	0.650	Hepatocyte growth factor receptor
5	9606.ENSP00000442682	0.628	Arf-GAP with dual PH domain-containing protein 1
6	9606.ENSP00000343656	0.625	Rap guanine nucleotide exchange factor 5
7	9606.ENSP00000222573	0.599	Integrin beta-8
8	9606.ENSP00000483599	0.588	Spondin-2
9	9606.ENSP00000369014	0.553	Protein NDNF
10	9606.ENSP00000222390	0.539	Hepatocyte growth factor
11	9606.ENSP00000360798	0.539	Epidermal growth factor receptor substrate 15
12	9606.ENSP00000311453	0.503	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0031267	1.000	small GTPase binding
GO:0005092	1.000	GDP-dissociation inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.991	positive regulation of cellular process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0010557	0.977	positive regulation of macromolecule biosynthetic process
GO:0031328	0.977	positive regulation of cellular biosynthetic process
GO:0045935	0.977	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.972	positive regulation of DNA-templated transcription
GO:0006357	0.971	regulation of transcription by RNA polymerase II
GO:0045944	0.901	positive regulation of transcription by RNA polymerase II
GO:0009987	0.425	cellular process
GO:0048856	0.387	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.991	mitochondrion
GO:0005576	0.575	extracellular region
GO:0016020	0.563	membrane
GO:0005829	0.521	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]