StarFunc result for job id Q6ZN30

User Input

>input (1099 residues)
MAHLGPTPPPHSLNYKSEDRLSEQDWPAYFKVPCCGVDTSQIESEEAEVDVRERETQRDR
EPKRARDLTLRDSCTDNSMQFGTRTTTAEPGFMGTWQNADTNLLFRMSQQAIRCTLVNCT
CECFQPGKINLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQ
AVPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRDYVRGYILQDAAGKVLDRWAIMSREE
EIITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSSKTDSDIRTFIESNNRTRSPSLLAH
LENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPGLRLREPSLSTQ
NEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHP
KSSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVF
SSLRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLALTSPGRPPMG
FTTPPLDPVLQNPLPSQLVFSGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGT
IEQHPPPPSEPVVPAVMMATHEPSADLAPKKKPRKSSMPVKIEKEIIDTADEFDDEDDDP
NDGGAVVNDMSHDNHCHSQEEMSPGMSVKDFSKHNRTRCISRTEIRRADSMTSEDQEPER
DYENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTD
PTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKK
SFKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMG
LDSSQPSLSKDLRDEFLVKIYGAQHPMGLDVREDASSPAGTEDSHLNGYGRGMAEDYMVL
DLSTTSSLQSSSSIHSSRESDAGSDEGILLDDIDGASDSGESAHKAEAPALPGSLGAEVS
GSLMFSSLSGSNGGIMCNICHKMYSNKGTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSR
NRHSQNPNLHKNIPFTSVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IKC9	0.186	0.164	0.000	1268	0.673	0.584	A0A0R4IKC9.pdb.gz	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
2	AFDB:Q8BMQ3	0.186	0.183	0.000	1127	0.970	0.946	Q8BMQ3.pdb.gz	BNC2_MOUSE Zinc finger protein basonuclin-2 OS=Mus musculus OX=10090 GN=Bnc2 PE=1 SV=3
3	AFDB:O35914	0.173	0.196	7.896E-67	961	0.397	0.454	O35914.pdb.gz	BNC1_MOUSE Zinc finger protein basonuclin-1 OS=Mus musculus OX=10090 GN=Bnc1 PE=1 SV=1
4	AFDB:Q9VXJ5	0.074	0.065	6.693E-19	1311	0.203	0.170	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
5	AFDB:Q5EXX3	0.053	0.050	5.375E-6	1203	0.126	0.116	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
6	AFDB:Q8NAP3	0.048	0.046	3.928E-5	1195	0.140	0.129	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
7	AFDB:Q13029	0.048	0.033	3.239E-4	1718	0.148	0.095	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
8	AFDB:A0A0G2JU33	0.056	0.046	9.024E-4	1493	0.140	0.103	A0A0G2JU33.pdb.gz	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
9	AFDB:Q7KHG2	0.042	0.034	1.552E-3	1486	0.170	0.126	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
10	AFDB:A1Z6M0	0.049	0.036	8.392E-3	1688	0.129	0.084	A1Z6M0.pdb.gz	A1Z6M0_DROME Brahma associated protein 170kD OS=Drosophila melanogaster OX=7227 GN=Bap170 PE=1 SV=1
11	PDB:3w5kB	0.030	0.209	6.437E-1	110	0.010	0.100	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6zqeUH	0.043	0.084	2.575	479	0.024	0.054	6zqeUH.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
13	PDB:3oeiB	0.033	0.173	3.085	91	0.012	0.143	3oeiB.pdb.gz
14	PDB:6ydhA	0.023	0.229	3.480	62	0.008	0.145	6ydhA.pdb.gz
15	PDB:3n71A	0.037	0.074	3.697	468	0.015	0.034	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
16	PDB:6t9iE	0.041	0.082	3.926	433	0.024	0.060	6t9iE.pdb.gz
17	PDB:7sp4u	0.039	0.158	3.926	158	0.017	0.120	7sp4u.pdb.gz
18	PDB:2nyxB	0.036	0.126	4.429	147	0.010	0.075	2nyxB.pdb.gz
19	PDB:1i7fA	0.020	0.069	4.997	228	0.014	0.066	1i7fA.pdb.gz
20	PDB:5gynA	0.022	0.062	5.987	295	0.006	0.024	5gynA.pdb.gz	Crystal structure of human pyridoxal 5'-phosphate phosphatase (Chronophin) mutant - C221S

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IKC9	0.0	886	1268	0.409	0.354	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
2	A0A2R8QKL6	0.0	888	1223	0.409	0.367	A0A2R8QKL6_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
3	B1APH0	0.0	2049	1032	0.900	0.958	B1APH0_HUMAN Basonuclin 2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
4	C7DZJ6	0.0	887	1171	0.409	0.383	C7DZJ6_DANRE Basonuclin-2 OS=Danio rerio OX=7955 GN=bnp PE=2 SV=1
5	F1R425	0.0	886	978	0.409	0.459	F1R425_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=2
6	F5H586	0.0	1464	729	0.646	0.974	F5H586_HUMAN Basonuclin 2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=2
7	H0Y6W5	0.0	1745	860	0.765	0.978	H0Y6W5_HUMAN Basonuclin 2 (Fragment) OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
8	Q6ZN30	0.0	2287	1099	1.000	1.000	BNC2_HUMAN Zinc finger protein basonuclin-2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
9	Q8BMQ3	0.0	2215	1127	0.971	0.947	BNC2_MOUSE Zinc finger protein basonuclin-2 OS=Mus musculus OX=10090 GN=Bnc2 PE=1 SV=3
10	Q01954	5.40e-173	536	994	0.272	0.301	BNC1_HUMAN Zinc finger protein basonuclin-1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=2
11	F5GY04	9.36e-173	535	987	0.271	0.302	F5GY04_HUMAN Basonuclin 1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=1
12	O35914	7.56e-170	527	961	0.273	0.312	BNC1_MOUSE Zinc finger protein basonuclin-1 OS=Mus musculus OX=10090 GN=Bnc1 PE=1 SV=1
13	P23792	6.41e-18	91.3	568	0.051	0.099	DISC_DROME Protein disconnected OS=Drosophila melanogaster OX=7227 GN=disco PE=1 SV=2
14	Q9GSZ5	6.12e-17	88.6	729	0.035	0.053	Q9GSZ5_DROME Disco-related protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=disco-r PE=2 SV=1
15	Q9VXJ5	9.48e-17	88.6	1311	0.035	0.030	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
16	Q1ZXU0	5.34e-11	65.5	205	0.036	0.195	BNCH_CAEEL Basonuclin zinc finger protein homolog OS=Caenorhabditis elegans OX=6239 GN=bnc-1 PE=1 SV=1
17	J3KTI4	0.007	43.1	1091	0.055	0.055	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
18	Q96K83	0.012	42.4	1311	0.055	0.046	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
19	Q6KAS7	0.018	41.6	1311	0.056	0.047	ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus OX=10090 GN=Znf521 PE=1 SV=2
20	A0MWC1	0.032	40.8	1091	0.025	0.026	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	9.9e-07	40.0	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.0034	29.1	C2H2-type zinc finger
3	PF17017 zf-C2H2_aberr	93	14.6	Aberrant zinc-finger
4	PF12171 zf-C2H2_jaz	9.8	17.8	Zinc-finger double-stranded RNA-binding
5	PF12874 zf-met	0.007	27.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376276	0.764	Serine/arginine-rich splicing factor 2
2	9606.ENSP00000344989	0.708	DALR anticodon-binding domain-containing protein 3
3	9606.ENSP00000267119	0.681	Keratin, type II cytoskeletal 71
4	9606.ENSP00000273590	0.633	T-cell leukemia translocation-altered gene protein
5	9606.ENSP00000373570	0.633	5,6-dihydroxyindole-2-carboxylic acid oxidase
6	9606.ENSP00000370021	0.618	Centlein
7	9606.ENSP00000378857	0.618	WD repeat-containing protein 6
8	9606.ENSP00000301917	0.610	Probable G-protein coupled receptor 25
9	9606.ENSP00000369981	0.594	Endophilin-A1
10	9606.ENSP00000346659	0.566	P protein
11	9606.ENSP00000329357	0.545	Transcription factor Sp1
12	9606.ENSP00000359212	0.545	Transcription factor LBX1
13	9606.ENSP00000370077	0.541	Coiled-coil domain containing 171
14	9606.ENSP00000296589	0.540	Membrane-associated transporter protein
15	9606.ENSP00000482245	0.535	Dachshund homolog 1
16	9606.ENSP00000341550	0.505	Sodium/potassium/calcium exchanger 5
17	9606.ENSP00000451605	0.504	Melanocyte-stimulating hormone receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0000182	0.997	rDNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048513	0.989	animal organ development
GO:0032501	0.966	multicellular organismal process
GO:0007275	0.944	multicellular organism development
GO:0009888	0.935	tissue development
GO:0048731	0.918	system development
GO:0040007	0.658	growth
GO:0065007	0.490	biological regulation
GO:0048589	0.473	developmental growth
GO:0009987	0.460	cellular process
GO:0050789	0.406	regulation of biological process
GO:0035265	0.373	organ growth
GO:0050794	0.339	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.592	intracellular non-membrane-bounded organelle
GO:0016020	0.476	membrane
GO:0005737	0.343	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]