StarFunc result for job id Q6ZN32

User Input

>input (361 residues)
MHCSCLAEGIPANPGNWISGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAW
QQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFN
FSKLIVVNYPLWEVRAPPSPHLLLGAPALCRPALVPVGVQSELLHSMLFAHQAMVEQLTG
QQTPRGPPETSGDKKGSSSSVYRLGSAPGPCRLGLCCHLGSVQGELPGVASFTPPLPPPL
PSNWTCLSGPFLPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERL
WLLSLRPEGLEVKPAPMMEAKGGLDPREVFCPETRRLKTGEESLTSPNLENLKAVWPLDP
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZN32	1.000	1.000	3.706E-61	361	1.000	1.000	Q6ZN32.pdb.gz	ETV3L_HUMAN ETS translocation variant 3-like protein OS=Homo sapiens OX=9606 GN=ETV3L PE=1 SV=1
2	AFDB:Q8R4Z4	0.270	0.191	2.292E-19	513	0.402	0.283	Q8R4Z4.pdb.gz	ETV3_MOUSE ETS translocation variant 3 OS=Mus musculus OX=10090 GN=Etv3 PE=1 SV=2
3	AFDB:P70459	0.265	0.177	1.776E-17	551	0.427	0.279	P70459.pdb.gz	ERF_MOUSE ETS domain-containing transcription factor ERF OS=Mus musculus OX=10090 GN=Erf PE=1 SV=1
4	AFDB:P41969	0.249	0.212	7.669E-14	429	0.260	0.219	P41969.pdb.gz	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
5	AFDB:A0A024R1A7	0.251	0.214	4.256E-13	428	0.263	0.222	A0A024R1A7.pdb.gz
6	AFDB:A0A024R985	0.240	0.202	5.208E-12	431	0.266	0.223	A0A024R985.pdb.gz
7	AFDB:P41971	0.222	0.196	1.706E-11	409	0.274	0.242	P41971.pdb.gz	ELK3_MOUSE ETS domain-containing protein Elk-3 OS=Mus musculus OX=10090 GN=Elk3 PE=2 SV=3
8	AFDB:Q9EQY2	0.244	0.156	3.522E-11	579	0.249	0.155	Q9EQY2.pdb.gz
9	AFDB:G3V9V2	0.241	0.145	4.018E-11	615	0.266	0.156	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
10	AFDB:Q9EQY1	0.247	0.174	7.768E-11	524	0.260	0.179	Q9EQY1.pdb.gz
11	PDB:1ldjA	0.136	0.075	2.174E-1	725	0.030	0.015	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
12	PDB:2xv4S	0.113	0.104	7.119E-1	399	0.017	0.015	2xv4S.pdb.gz
13	PDB:4byyA	0.153	0.231	7.604E-1	226	0.033	0.053	4byyA.pdb.gz
14	PDB:5k1yD	0.086	0.258	7.604E-1	92	0.033	0.130	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
15	PDB:5exrB	0.082	0.071	9.898E-1	434	0.064	0.053	5exrB.pdb.gz	Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome.
16	PDB:4mtdD	0.127	0.265	1.057	151	0.044	0.106	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
17	PDB:1ft9A	0.135	0.206	1.206	210	0.047	0.081	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
18	PDB:3cuqC	0.085	0.162	1.206	173	0.044	0.092	3cuqC.pdb.gz
19	PDB:2zcwA	0.142	0.243	1.288	194	0.019	0.036	2zcwA.pdb.gz
20	PDB:6w6wC	0.123	0.133	1.288	323	0.044	0.050	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZN32	0.0	728	361	1.000	1.000	ETV3L_HUMAN ETS translocation variant 3-like protein OS=Homo sapiens OX=9606 GN=ETV3L PE=1 SV=1
2	Q8R4Z4	8.03e-72	234	513	0.294	0.207	ETV3_MOUSE ETS translocation variant 3 OS=Mus musculus OX=10090 GN=Etv3 PE=1 SV=2
3	P41162	1.39e-71	233	512	0.291	0.205	ETV3_HUMAN ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2
4	P50548	2.87e-65	218	548	0.421	0.277	ERF_HUMAN ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF PE=1 SV=2
5	P70459	2.47e-64	215	551	0.274	0.180	ERF_MOUSE ETS domain-containing transcription factor ERF OS=Mus musculus OX=10090 GN=Erf PE=1 SV=1
6	A3FEM2	2.64e-31	120	235	0.163	0.251	FEV_DANRE Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1
7	Q99581	3.92e-31	120	238	0.155	0.235	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1
8	O70132	4.34e-31	119	237	0.155	0.236	FEV_RAT Protein FEV OS=Rattus norvegicus OX=10116 GN=Fev PE=2 SV=2
9	Q8QZW2	4.34e-31	119	237	0.155	0.236	FEV_MOUSE Protein FEV OS=Mus musculus OX=10090 GN=Fev PE=2 SV=1
10	Q22355	5.24e-31	123	377	0.150	0.143	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
11	Q5MBG6	1.45e-30	123	458	0.152	0.120	Q5MBG6_DANRE ETS family transcription factor efr1 OS=Danio rerio OX=7955 GN=fli1b PE=2 SV=1
12	P81270	1.98e-30	123	486	0.155	0.115	ERG_MOUSE Transcriptional regulator ERG OS=Mus musculus OX=10090 GN=Erg PE=1 SV=2
13	P11308	4.08e-30	122	479	0.155	0.117	ERG_HUMAN Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=3
14	P26323	5.74e-30	121	452	0.155	0.124	FLI1_MOUSE Friend leukemia integration 1 transcription factor OS=Mus musculus OX=10090 GN=Fli1 PE=1 SV=1
15	Q01543	6.53e-30	121	452	0.155	0.124	FLI1_HUMAN Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1
16	Q5PR65	7.32e-30	120	427	0.155	0.131	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
17	Q9PU61	1.27e-29	120	451	0.155	0.124	Q9PU61_DANRE Fli-1 protein OS=Danio rerio OX=7955 GN=fli1a PE=1 SV=1
18	A0A2R8QGN6	1.36e-29	120	460	0.155	0.122	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
19	P29776	2.77e-29	119	475	0.150	0.114	ETS6_DROME DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2
20	P41969	7.87e-27	112	429	0.158	0.133	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	3.8e-29	112.1	Ets-domain
2	PF00447 HSF_DNA-bind	24	16.9	HSF-type DNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336661	0.800	Leucine-rich repeat-containing protein 71
2	9606.ENSP00000344465	0.611	Platelet endothelial aggregation receptor 1
3	9606.ENSP00000417451	0.559	RNA binding motif protein, X-linked like 3
4	9606.ENSP00000342188	0.520	Leucine rich repeats and IQ motif containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.994	nucleic acid binding
GO:0043565	0.983	sequence-specific DNA binding
GO:1990837	0.898	sequence-specific double-stranded DNA binding
GO:0003700	0.569	DNA-binding transcription factor activity
GO:0000981	0.482	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.396	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0009987	0.968	cellular process
GO:0051252	0.967	regulation of RNA metabolic process
GO:0009889	0.920	regulation of biosynthetic process
GO:0006355	0.905	regulation of DNA-templated transcription
GO:0032502	0.853	developmental process
GO:0048518	0.528	positive regulation of biological process
GO:0048522	0.451	positive regulation of cellular process
GO:0050896	0.353	response to stimulus
GO:0010604	0.330	positive regulation of macromolecule metabolic process
GO:0006357	0.330	regulation of transcription by RNA polymerase II
GO:0048856	0.324	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.845	membrane-enclosed lumen
GO:0031981	0.767	nuclear lumen
GO:0005654	0.685	nucleoplasm
GO:0005829	0.384	cytosol
GO:0016020	0.341	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]