StarFunc result for job id Q6ZNA4

User Input

>input (994 residues)
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKV
GNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQ
HLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKRE
VLARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVSASENHQNNPAVPSGSIDEDV
VVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSE
QASDTASAVTSSQPSTVSETSATLTSNSTTGTSIGDDSRRTTSSAVTETGPPAMPRLPSC
CPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQQALPVDLSNSGIRSHGSGSFHGASAFDPCCPVSSSRAA
IFGHQAAAAAPSQPLSSIDGYGSSMVAQPQPQPPPQPSLSSCRHYMPPPYASLTRPLHHQ
ASACPHSHGNPPPQTQPPPQVDYVIPHPVHAFHSQISSHATSHPVAPPPPTHLASTAAPI
PQHLPPTHQPISHHIPATAPPAQRLHPHEVMQRMEVQRRRMMQHPTRAHERPPPHPHRMH
PNYGHGHHIHVPQTMSSHPRQAPERSAWELGIEAGVTAATYTPGALHPHLAHYHAPPRLH
HLQLGALPLMVPDMAGYPHIRYISSGLDGTSFRGPFRGNFEELIHLEERLGNVNRGASQG
TIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPC
MHLFHQVCVDQWLITNKKCPICRVDIEAQLPSES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A9T1	0.168	0.169	0.000	987	0.905	0.912	D4A9T1.pdb.gz	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
2	AFDB:Q6ZNA4	0.999	0.999	0.000	994	1.000	1.000	Q6ZNA4.pdb.gz	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
3	AFDB:R4KWC4	0.133	0.128	8.061E-70	1032	0.580	0.559	R4KWC4.pdb.gz	R4KWC4_DANRE E3 ubiquitin-protein ligase Arkadia OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
4	AFDB:Q9VHC2	0.081	0.070	2.659E-11	1173	0.169	0.143	Q9VHC2.pdb.gz	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
5	AFDB:Q8SX72	0.080	0.090	1.842E-9	868	0.156	0.179	Q8SX72.pdb.gz	Q8SX72_DROME LD30050p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=1
6	AFDB:P47068	0.048	0.043	8.704E-5	1157	0.148	0.127	P47068.pdb.gz	BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BBC1 PE=1 SV=2
7	AFDB:B7YZW3	0.039	0.023	1.951E-4	2064	0.159	0.077	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
8	AFDB:F1M078	0.054	0.048	1.122E-3	1164	0.144	0.123	F1M078.pdb.gz	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
9	AFDB:Q9FXI5	0.055	0.065	1.796E-3	794	0.115	0.144	Q9FXI5.pdb.gz	IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana OX=3702 GN=IQD32 PE=1 SV=3
10	AFDB:P40021	0.041	0.038	2.198E-3	1076	0.138	0.127	P40021.pdb.gz	ZRG8_YEAST Zinc-regulated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZRG8 PE=1 SV=1
11	PDB:5l9uB	0.048	0.501	1.354E-1	71	0.017	0.239	5l9uB.pdb.gz
12	PDB:2lgvA	0.043	0.395	3.035E-1	100	0.017	0.170	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
13	PDB:4a0cF	0.042	0.467	3.035E-1	80	0.015	0.188	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:5gm6a	0.045	0.320	3.472E-1	123	0.019	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:4kfzB	0.037	0.190	5.476	148	0.015	0.101	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
16	PDB:7mqaNS	0.020	0.021	5.476	914	0.013	0.014	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7ao8C	0.024	0.257	6.264	64	0.008	0.125	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
18	PDB:6elzv	0.022	0.099	8.198	130	0.010	0.077	6elzv.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
19	PDB:6wg3A	0.024	0.039	8.198	561	0.008	0.014	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
20	PDB:2m1sA	0.048	0.339	9.379	99	0.013	0.131	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A9T1	0.0	1581	1011	0.897	0.882	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
2	F1QWE1	0.0	766	1004	0.569	0.564	F1QWE1_DANRE E3 ubiquitin-protein ligase Arkadia isoform X3 OS=Danio rerio OX=7955 GN=rnf111 PE=3 SV=2
3	N0A274	0.0	760	1003	0.568	0.563	N0A274_DANRE E3 ubiquitin-protein ligase Arkadia isoform X4 OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
4	Q6ZNA4	0.0	2033	994	1.000	1.000	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
5	Q99ML9	0.0	1618	989	0.905	0.910	RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus OX=10090 GN=Rnf111 PE=1 SV=1
6	R4KWC4	0.0	756	1032	0.570	0.549	R4KWC4_DANRE E3 ubiquitin-protein ligase Arkadia OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
7	H0YKS2	3.71e-87	277	131	0.132	1.000	H0YKS2_HUMAN Ring finger protein 111 (Fragment) OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=1
8	H0YKK5	6.50e-67	222	128	0.106	0.820	H0YKK5_HUMAN Ring finger protein 111 (Fragment) OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=1
9	E9QAU8	3.50e-66	228	347	0.146	0.418	ARK2C_MOUSE E3 ubiquitin-protein ligase ARK2C OS=Mus musculus OX=10090 GN=Ark2c PE=1 SV=1
10	Q6ZSG1	9.05e-65	224	346	0.145	0.416	ARK2C_HUMAN E3 ubiquitin-protein ligase ARK2C OS=Homo sapiens OX=9606 GN=ARK2C PE=1 SV=1
11	Q8NC42	3.10e-12	72.0	400	0.028	0.070	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
12	Q3U2C5	3.61e-12	71.6	394	0.028	0.071	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
13	Q7XTV7	6.99e-12	72.0	667	0.040	0.060	HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica OX=39947 GN=HIP1 PE=1 SV=2
14	Q8R4E3	8.25e-12	70.9	432	0.037	0.086	Q8R4E3_RAT RING finger protein OIP1 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=2 SV=1
15	Q7L0R7	1.27e-11	70.5	432	0.038	0.088	RNF44_HUMAN RING finger protein 44 OS=Homo sapiens OX=9606 GN=RNF44 PE=1 SV=1
16	A0A8I5XVZ9	1.64e-11	70.5	526	0.037	0.070	A0A8I5XVZ9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
17	A0A0G2K236	1.82e-11	70.5	573	0.037	0.065	A0A0G2K236_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
18	A0A8I5ZQX4	2.03e-11	70.1	514	0.037	0.072	A0A8I5ZQX4_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
19	A0A0G2K8H9	2.24e-11	70.1	623	0.037	0.059	A0A0G2K8H9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1
20	A0A8I5ZJ72	2.27e-11	70.1	577	0.037	0.064	A0A8I5ZJ72_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	2.4	19.4	Prokaryotic RING finger family 4
2	PF15303 RNF111_N	4.8e-128	438.0	E3 ubiquitin-protein ligase Arkadia N-terminus
3	PF00097 zf-C3HC4	0.0061	27.7	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	7.8e-06	36.9	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.0032	28.6	Zinc finger, C3HC4 type (RING finger)
6	PF12678 zf-rbx1	0.0014	30.2	RING-H2 zinc finger domain
7	PF17123 zf-RING_11	0.00012	33.1	RING-like zinc finger
8	PF13639 zf-RING_2	2.9e-09	48.4	Ring finger domain
9	PF14634 zf-RING_5	0.0094	27.2	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000012176

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017016	0.954	Mothers against decapentaplegic homolog
2	9598.ENSPTRP00000012318	0.853	Mothers against decapentaplegic homolog
3	9598.ENSPTRP00000060506	0.851	Small ubiquitin-related modifier
4	9598.ENSPTRP00000021908	0.836	Small ubiquitin-like modifier 1
5	9598.ENSPTRP00000026869	0.804	SKI-like oncogene
6	9598.ENSPTRP00000038891	0.786	Uncharacterized protein
7	9598.ENSPTRP00000042391	0.773	Uncharacterized protein
8	9598.ENSPTRP00000024078	0.764	Small ubiquitin-related modifier
9	9598.ENSPTRP00000006178	0.753	Damage-specific DNA binding protein 2, 48kDa
10	9598.ENSPTRP00000038570	0.748	Centrin, EF-hand protein, 2
11	9598.ENSPTRP00000010296	0.736	Cullin 4A
12	9598.ENSPTRP00000018011	0.721	Uncharacterized protein
13	9598.ENSPTRP00000038292	0.717	Uncharacterized protein
14	9598.ENSPTRP00000048051	0.701	Damage-specific DNA binding protein 1, 127kDa
15	9598.ENSPTRP00000017009	0.695	Mothers against decapentaplegic homolog
16	9598.ENSPTRP00000030616	0.689	General transcription factor IIH subunit 4
17	9598.ENSPTRP00000012319	0.686	Mothers against decapentaplegic homolog
18	9598.ENSPTRP00000051558	0.682	Uncharacterized protein
19	9598.ENSPTRP00000036174	0.673	Uncharacterized protein
20	9598.ENSPTRP00000046785	0.665	Chromodomain helicase DNA binding protein 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032183	1.000	SUMO binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0046332	0.843	SMAD binding
GO:0032184	0.551	SUMO polymer binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.981	response to stimulus
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0048518	0.961	positive regulation of biological process
GO:0044260	0.960	cellular macromolecule metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0019538	0.957	protein metabolic process
GO:0045935	0.953	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.942	regulation of DNA-templated transcription
GO:0032446	0.930	protein modification by small protein conjugation
GO:0051716	0.913	cellular response to stimulus
GO:0016567	0.903	protein ubiquitination
GO:0010604	0.880	positive regulation of macromolecule metabolic process
GO:0051254	0.861	positive regulation of RNA metabolic process
GO:0010557	0.858	positive regulation of macromolecule biosynthetic process
GO:0006950	0.734	response to stress
GO:0006974	0.684	cellular response to DNA damage stimulus
GO:0034641	0.673	cellular nitrogen compound metabolic process
GO:1903508	0.649	positive regulation of nucleic acid-templated transcription
GO:0090304	0.639	nucleic acid metabolic process
GO:0006281	0.580	DNA repair
GO:0051246	0.466	regulation of protein metabolic process
GO:0048583	0.430	regulation of response to stimulus
GO:0045893	0.410	positive regulation of DNA-templated transcription
GO:0009966	0.385	regulation of signal transduction
GO:0048856	0.346	anatomical structure development
GO:0032501	0.330	multicellular organismal process
GO:0007275	0.309	multicellular organism development
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.928	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]