StarFunc result for job id Q6ZNC8

User Input

>input (495 residues)
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTS
SDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTI
CHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKP
SFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGA
VIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAW
TLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCV
CYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA
VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQ
RRPQTLNSINKRKTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZNC8	1.000	1.000	2.890E-65	495	1.000	1.000	Q6ZNC8.pdb.gz	MBOA1_HUMAN Lysophospholipid acyltransferase 1 OS=Homo sapiens OX=9606 GN=MBOAT1 PE=1 SV=1
2	AFDB:Q8BH98	0.967	0.973	7.352E-56	492	0.826	0.831	Q8BH98.pdb.gz	MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus OX=10090 GN=Mboat1 PE=1 SV=1
3	AFDB:Q6ZWT7	0.924	0.880	5.011E-43	520	0.525	0.500	Q6ZWT7.pdb.gz	MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens OX=9606 GN=MBOAT2 PE=1 SV=2
4	AFDB:Q8R3I2	0.917	0.875	2.090E-42	519	0.519	0.495	Q8R3I2.pdb.gz	MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus OX=10090 GN=Mboat2 PE=1 SV=1
5	AFDB:Q6NN55	0.856	0.592	5.464E-27	722	0.388	0.266	Q6NN55.pdb.gz	MBOA6_DROME Lysophospholipid acyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=oys PE=1 SV=1
6	AFDB:O42916	0.820	0.798	1.932E-23	509	0.257	0.250	O42916.pdb.gz	ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ale1 PE=1 SV=1
7	AFDB:Q9CAN8	0.819	0.870	1.064E-22	465	0.263	0.280	Q9CAN8.pdb.gz	MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPCAT2 PE=1 SV=1
8	AFDB:F4IDU4	0.813	0.869	1.350E-22	462	0.261	0.279	F4IDU4.pdb.gz	MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=LPCAT1 PE=1 SV=1
9	AFDB:Q08548	0.835	0.672	2.983E-22	619	0.246	0.197	Q08548.pdb.gz	ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALE1 PE=1 SV=1
10	AFDB:A0A1D8PHX1	0.836	0.693	5.855E-22	602	0.236	0.194	A0A1D8PHX1.pdb.gz	A0A1D8PHX1_CANAL Lysophospholipid acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPT1 PE=4 SV=1
11	PDB:7uraA	0.659	0.748	8.797E-12	432	0.170	0.194	7uraA.pdb.gz	Mechanisms and inhibition of Porcupine-mediated Wnt acylation.
12	PDB:7mhyA	0.562	0.566	5.845E-6	491	0.113	0.114	7mhyA.pdb.gz	Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT.
13	PDB:6vz1A	0.377	0.436	5.377E-4	411	0.133	0.161	6vz1A.pdb.gz	Structure and catalytic mechanism of a human triacylglycerol-synthesis enzyme.
14	PDB:7n6qA	0.355	0.441	1.287E-3	375	0.113	0.149	7n6qA.pdb.gz	Structure of PPPA bound human ACAT2
15	PDB:7jm7A	0.142	0.116	2.839E-2	683	0.109	0.079	7jm7A.pdb.gz	Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1.
16	PDB:7w55R	0.100	0.144	1.832E-1	303	0.101	0.165	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
17	PDB:7w2zR	0.126	0.171	2.324E-1	301	0.085	0.140	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
18	PDB:7qsoM	0.191	0.199	2.948E-1	459	0.095	0.102	7qsoM.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:7p5jA	0.092	0.110	3.067E-1	399	0.129	0.160	7p5jA.pdb.gz
20	PDB:5d5aA	0.136	0.147	3.320E-1	442	0.085	0.095	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZNC8	0.0	1023	495	1.000	1.000	MBOA1_HUMAN Lysophospholipid acyltransferase 1 OS=Homo sapiens OX=9606 GN=MBOAT1 PE=1 SV=1
2	Q6ZWT7	0.0	539	520	0.523	0.498	MBOA2_HUMAN Lysophospholipid acyltransferase 2 OS=Homo sapiens OX=9606 GN=MBOAT2 PE=1 SV=2
3	Q8BH98	0.0	803	492	0.826	0.831	MBOA1_MOUSE Lysophospholipid acyltransferase 1 OS=Mus musculus OX=10090 GN=Mboat1 PE=1 SV=1
4	Q8R3I2	0.0	531	519	0.515	0.491	MBOA2_MOUSE Lysophospholipid acyltransferase 2 OS=Mus musculus OX=10090 GN=Mboat2 PE=1 SV=1
5	Q6NN55	7.77e-116	359	722	0.392	0.269	MBOA6_DROME Lysophospholipid acyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=oys PE=1 SV=1
6	Q8T8Q2	2.26e-49	177	451	0.176	0.193	Q8T8Q2_DROME SD07362p OS=Drosophila melanogaster OX=7227 GN=oys PE=2 SV=1
7	Q08548	2.82e-48	177	619	0.240	0.192	ALE1_YEAST Lysophospholipid acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALE1 PE=1 SV=1
8	O42916	1.94e-47	173	509	0.297	0.289	ALE1_SCHPO Lysophospholipid acyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ale1 PE=1 SV=1
9	A0A1D8PHX1	2.56e-43	164	602	0.214	0.176	A0A1D8PHX1_CANAL Lysophospholipid acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPT1 PE=4 SV=1
10	F4IDU4	2.79e-40	153	462	0.263	0.281	MBOA1_ARATH Lysophospholipid acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=LPCAT1 PE=1 SV=1
11	Q9CAN8	8.20e-37	143	465	0.255	0.271	MBOA2_ARATH Lysophospholipid acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPCAT2 PE=1 SV=1
12	P0C7A3	7.60e-30	123	435	0.222	0.253	MBOA4_MOUSE Ghrelin O-acyltransferase OS=Mus musculus OX=10090 GN=Mboat4 PE=1 SV=1
13	B1Q005	2.21e-29	122	435	0.204	0.232	MBOA4_RAT Ghrelin O-acyltransferase OS=Rattus norvegicus OX=10116 GN=Mboat4 PE=1 SV=1
14	Q91V01	7.37e-27	115	487	0.226	0.230	MBOA5_MOUSE Lysophospholipid acyltransferase 5 OS=Mus musculus OX=10090 GN=Lpcat3 PE=1 SV=1
15	Q96T53	1.17e-25	111	435	0.198	0.225	MBOA4_HUMAN Ghrelin O-acyltransferase OS=Homo sapiens OX=9606 GN=MBOAT4 PE=1 SV=2
16	Q6P1A2	2.76e-24	107	487	0.232	0.236	MBOA5_HUMAN Lysophospholipid acyltransferase 5 OS=Homo sapiens OX=9606 GN=LPCAT3 PE=1 SV=1
17	B1Q006	4.00e-23	103	415	0.210	0.251	MBOA4_DANRE Ghrelin O-acyltransferase OS=Danio rerio OX=7955 GN=mboat4 PE=1 SV=1
18	Q9VVX5	2.08e-20	96.3	497	0.212	0.211	MBOA5_DROME Lysophospholipid acyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=nes PE=1 SV=1
19	O01925	4.74e-18	89.0	473	0.216	0.226	MBOA5_CAEEL Lysophospholipid acyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=mboa-6 PE=1 SV=2
20	Q8CHK3	4.99e-17	85.9	473	0.216	0.226	MBOA7_MOUSE Lysophospholipid acyltransferase 7 OS=Mus musculus OX=10090 GN=Mboat7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03062 MBOAT	6.7e-23	93.2	MBOAT, membrane-bound O-acyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441980	0.960	Choline/ethanolaminephosphotransferase 1
2	9606.ENSP00000371586	0.955	Phosphatidylserine decarboxylase proenzyme, mitochondrial
3	9606.ENSP00000378877	0.953	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
4	9606.ENSP00000482571	0.949	Glycerol-3-phosphate acyltransferase 3
5	9606.ENSP00000310551	0.948	Lysocardiolipin acyltransferase 1
6	9606.ENSP00000380184	0.948	Glycerol-3-phosphate acyltransferase 4
7	9606.ENSP00000360761	0.947	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
8	9606.ENSP00000265276	0.943	Glycerol-3-phosphate acyltransferase 1, mitochondrial
9	9606.ENSP00000255389	0.940	Phosphatidylethanolamine N-methyltransferase
10	9606.ENSP00000273371	0.936	Phospholipase A1 member A
11	9606.ENSP00000389395	0.932	Glycerol-3-phosphate acyltransferase 2, mitochondrial
12	9606.ENSP00000314036	0.927	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
13	9606.ENSP00000308258	0.926	Phosphatidylserine synthase 2
14	9606.ENSP00000295887	0.925	Phosphatidate cytidylyltransferase 1
15	9606.ENSP00000419879	0.925	Phosphatidate cytidylyltransferase 2
16	9606.ENSP00000264775	0.922	Phospholipid phosphatase 1
17	9606.ENSP00000381140	0.920	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
18	9606.ENSP00000260585	0.919	Ethanolaminephosphotransferase 1
19	9606.ENSP00000317300	0.916	Lysophospholipid acyltransferase LPCAT4
20	9606.ENSP00000360296	0.915	Phospholipid phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008374	1.000	O-acyltransferase activity
GO:0071617	0.998	lysophospholipid acyltransferase activity
GO:0016411	0.992	acylglycerol O-acyltransferase activity
GO:0042171	0.980	lysophosphatidic acid acyltransferase activity
GO:0003841	0.960	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005488	0.615	binding
GO:0106262	0.579	1-acylglycerophosphoethanolamine O-acyltransferase activity
GO:0005515	0.530	protein binding
GO:0106263	0.392	1-acylglycerophosphoserine O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0006796	0.995	phosphate-containing compound metabolic process
GO:0019637	0.995	organophosphate metabolic process
GO:0046470	0.993	phosphatidylcholine metabolic process
GO:0009058	0.598	biosynthetic process
GO:1901576	0.561	organic substance biosynthetic process
GO:0008610	0.475	lipid biosynthetic process
GO:0065007	0.446	biological regulation
GO:0008654	0.443	phospholipid biosynthetic process
GO:0044249	0.432	cellular biosynthetic process
GO:0050789	0.407	regulation of biological process
GO:0006575	0.345	cellular modified amino acid metabolic process
GO:0050794	0.325	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:19709	0.960	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.960	1-acylglycerol-3-phosphate O-acyltransferase.
RHEA:32995	0.579	a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA
RHEA:33191	0.392	a 1-acyl-sn-glycero-3-phospho-L-serine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CoA

[back to server]