StarFunc result for job id Q6ZNE5

User Input

>input (492 residues)
MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQ
SGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRI
EQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
IDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEA
RRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPA
YTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCF
SQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAAS
VTSWFKAYTGHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZNE5	1.000	1.000	3.548E-78	492	1.000	1.000	Q6ZNE5.pdb.gz	BAKOR_HUMAN Beclin 1-associated autophagy-related key regulator OS=Homo sapiens OX=9606 GN=ATG14 PE=1 SV=1
2	AFDB:Q9VAP6	0.569	0.558	1.755E-23	503	0.248	0.243	Q9VAP6.pdb.gz	Q9VAP6_DROME Autophagy-related 14 OS=Drosophila melanogaster OX=7227 GN=Atg14 PE=1 SV=1
3	AFDB:Q9XWQ4	0.352	0.398	8.601E-8	428	0.159	0.182	Q9XWQ4.pdb.gz	Q9XWQ4_CAEEL MRG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-8 PE=4 SV=2
4	AFDB:F1RBZ5	0.319	0.251	6.012E-6	664	0.142	0.105	F1RBZ5.pdb.gz
5	AFDB:E7EY87	0.312	0.238	1.186E-5	693	0.159	0.113	E7EY87.pdb.gz	E7EY87_DANRE UV radiation resistance-associated gene OS=Danio rerio OX=7955 GN=Uvrag1 PE=1 SV=1
6	AFDB:Q8K245	0.288	0.221	1.488E-5	698	0.163	0.115	Q8K245.pdb.gz	UVRAG_MOUSE UV radiation resistance-associated protein OS=Mus musculus OX=10090 GN=Uvrag PE=1 SV=2
7	AFDB:Q9P2Y5	0.267	0.199	2.340E-5	699	0.163	0.114	Q9P2Y5.pdb.gz	UVRAG_HUMAN UV radiation resistance-associated gene protein OS=Homo sapiens OX=9606 GN=UVRAG PE=1 SV=1
8	AFDB:Q586T5	0.335	0.295	6.610E-4	575	0.118	0.101	Q586T5.pdb.gz	Q586T5_TRYB2 UV radiation resistance-associated gene protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.95 PE=4 SV=1
9	AFDB:A7DT33	0.334	0.454	3.227E-3	339	0.116	0.168	A7DT33.pdb.gz	A7DT33_CAEEL UV radiation resistance-associated gene protein-like OS=Caenorhabditis elegans OX=6239 GN=CELE_Y34B4A.2 PE=4 SV=2
10	AFDB:O42862	0.189	0.229	3.614E-3	390	0.136	0.172	O42862.pdb.gz	ATG14_SCHPO Autophagy-related protein 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg14 PE=1 SV=1
11	PDB:7sk1A	0.067	0.104	8.407E-1	262	0.045	0.084	7sk1A.pdb.gz
12	PDB:6wxuB	0.073	0.114	1.399	273	0.057	0.103	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
13	PDB:3duhC	0.096	0.248	1.481	137	0.026	0.095	3duhC.pdb.gz
14	PDB:6wvdA	0.062	0.073	1.857	397	0.047	0.058	6wvdA.pdb.gz
15	PDB:7qpgW	0.065	0.048	1.857	779	0.067	0.042	7qpgW.pdb.gz
16	PDB:4ksaA	0.075	0.081	2.080	437	0.055	0.062	4ksaA.pdb.gz
17	PDB:4hkaA	0.072	0.097	2.201	345	0.043	0.061	4hkaA.pdb.gz	Crystal structure of Drosophila melanogaster tryptophan 2,3-dioxygenase reveals insights into substrate recognition and catalytic mechanism.
18	PDB:5d9vA	0.069	0.126	2.201	211	0.043	0.100	5d9vA.pdb.gz	Structural understanding of the recycling of oxidized ascorbate by dehydroascorbate reductase (OsDHAR) from Oryza sativa L. japonica
19	PDB:1sqfA	0.084	0.093	2.609	425	0.041	0.047	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
20	PDB:7tvzA	0.063	0.046	2.609	850	0.059	0.034	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZNE5	0.0	1026	492	1.000	1.000	BAKOR_HUMAN Beclin 1-associated autophagy-related key regulator OS=Homo sapiens OX=9606 GN=ATG14 PE=1 SV=1
2	Q8CDJ3	0.0	955	492	0.931	0.931	BAKOR_MOUSE Beclin 1-associated autophagy-related key regulator OS=Mus musculus OX=10090 GN=Atg14 PE=1 SV=1
3	Q9VAP6	3.14e-44	164	503	0.258	0.252	Q9VAP6_DROME Autophagy-related 14 OS=Drosophila melanogaster OX=7227 GN=Atg14 PE=1 SV=1
4	Q9XWQ4	0.087	37.7	428	0.055	0.063	Q9XWQ4_CAEEL MRG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-8 PE=4 SV=2
5	H1UBJ2	0.11	37.0	270	0.055	0.100	H1UBJ2_CAEEL MRG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-8 PE=4 SV=1
6	F1MF50	0.12	37.7	1356	0.126	0.046	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
7	Q8IDX6	0.12	37.7	3130	0.067	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
8	H1UBJ1	0.13	37.0	347	0.055	0.078	H1UBJ1_CAEEL MRG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-8 PE=4 SV=1
9	F1RME6	0.87	34.7	662	0.049	0.036	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
10	Q8C7B8	1.3	34.3	1101	0.051	0.023	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
11	A0A8C0NIR0	1.4	34.3	1355	0.085	0.031	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1
12	Q13464	1.5	33.9	1354	0.085	0.031	ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1
13	O60383	3.8	32.3	454	0.047	0.051	GDF9_HUMAN Growth/differentiation factor 9 OS=Homo sapiens OX=9606 GN=GDF9 PE=1 SV=1
14	F6LJD1	5.0	32.3	699	0.033	0.023	F6LJD1_CHLRE CIA6 OS=Chlamydomonas reinhardtii OX=3055 PE=2 SV=1
15	Q0KHQ5	6.2	32.0	1039	0.071	0.034	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
16	O70196	7.5	31.6	710	0.091	0.063	PPCE_RAT Prolyl endopeptidase OS=Rattus norvegicus OX=10116 GN=Prep PE=1 SV=1
17	Q02328	8.0	31.6	927	0.041	0.022	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
18	P70335	8.1	31.6	1354	0.083	0.030	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
19	Q8I4Z1	9.5	31.6	1846	0.055	0.015	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
20	Q9VS33	10.0	31.2	460	0.063	0.067	Q9VS33_DROME Folliculin OS=Drosophila melanogaster OX=7227 GN=BHD PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	1.2e-74	262.9	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF02601 Exonuc_VII_L	53	14.8	Exonuclease VII, large subunit
3	PF12631 MnmE_helical	42	15.8	MnmE helical domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259400	0.999	Syntaxin-17
2	9606.ENSP00000262039	0.999	Phosphatidylinositol 3-kinase catalytic subunit type 3
3	9606.ENSP00000349205	0.999	Phosphoinositide 3-kinase regulatory subunit 4
4	9606.ENSP00000355231	0.999	Beclin-1
5	9606.ENSP00000432412	0.999	Autophagy-related protein 13
6	9606.ENSP00000324560	0.998	Serine/threonine-protein kinase ULK1
7	9606.ENSP00000277746	0.997	Nuclear receptor-binding factor 2
8	9606.ENSP00000025008	0.996	RB1-inducible coiled-coil protein 1
9	9606.ENSP00000431926	0.995	Activating molecule in BECN1-regulated autophagy protein 1
10	9606.ENSP00000348455	0.994	UV radiation resistance-associated gene protein
11	9606.ENSP00000338990	0.993	Autophagy-related protein 101
12	9606.ENSP00000266458	0.990	Gamma-aminobutyric acid receptor-associated protein-like 1
13	9606.ENSP00000386710	0.982	Autophagy-related protein 9A
14	9606.ENSP00000306866	0.979	Gamma-aminobutyric acid receptor-associated protein
15	9606.ENSP00000037243	0.976	Gamma-aminobutyric acid receptor-associated protein-like 2
16	9606.ENSP00000425107	0.973	Ubiquitin-like protein ATG12
17	9606.ENSP00000215730	0.972	Synaptosomal-associated protein 29
18	9606.ENSP00000358072	0.971	Autophagy protein 5
19	9606.ENSP00000378914	0.970	Serine/threonine-protein kinase ULK2
20	9606.ENSP00000375872	0.959	Autophagy-related protein 16-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051020	0.996	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0044237	0.987	cellular metabolic process
GO:0050896	0.979	response to stimulus
GO:0042325	0.968	regulation of phosphorylation
GO:0009267	0.968	cellular response to starvation
GO:0048518	0.967	positive regulation of biological process
GO:0080090	0.964	regulation of primary metabolic process
GO:0006796	0.963	phosphate-containing compound metabolic process
GO:0048522	0.956	positive regulation of cellular process
GO:0051179	0.954	localization
GO:0019216	0.952	regulation of lipid metabolic process
GO:0071704	0.950	organic substance metabolic process
GO:0009893	0.946	positive regulation of metabolic process
GO:0051246	0.943	regulation of protein metabolic process
GO:0031325	0.939	positive regulation of cellular metabolic process
GO:0044238	0.937	primary metabolic process
GO:1905037	0.936	autophagosome organization
GO:0010506	0.932	regulation of autophagy
GO:0001932	0.924	regulation of protein phosphorylation
GO:0065009	0.904	regulation of molecular function
GO:0042327	0.904	positive regulation of phosphorylation
GO:0051641	0.885	cellular localization
GO:0006810	0.878	transport
GO:0016192	0.869	vesicle-mediated transport
GO:0036211	0.852	protein modification process
GO:0022411	0.851	cellular component disassembly
GO:0051649	0.848	establishment of localization in cell
GO:0043549	0.848	regulation of kinase activity
GO:0046907	0.837	intracellular transport
GO:0000045	0.827	autophagosome assembly
GO:1903008	0.766	organelle disassembly
GO:0016241	0.738	regulation of macroautophagy
GO:0048519	0.699	negative regulation of biological process
GO:0048523	0.690	negative regulation of cellular process
GO:0016310	0.685	phosphorylation
GO:0007005	0.669	mitochondrion organization
GO:0043550	0.668	regulation of lipid kinase activity
GO:0009058	0.664	biosynthetic process
GO:0008654	0.651	phospholipid biosynthetic process
GO:0043551	0.623	regulation of phosphatidylinositol 3-kinase activity
GO:0044249	0.543	cellular biosynthetic process
GO:0006650	0.489	glycerophospholipid metabolic process
GO:0097352	0.402	autophagosome maturation
GO:0051640	0.395	organelle localization
GO:0006468	0.391	protein phosphorylation
GO:0000422	0.377	autophagy of mitochondrion
GO:0010604	0.369	positive regulation of macromolecule metabolic process
GO:0065008	0.362	regulation of biological quality
GO:0022406	0.350	membrane docking
GO:0007165	0.322	signal transduction
GO:0007041	0.319	lysosomal transport
GO:0046854	0.315	phosphatidylinositol phosphate biosynthetic process
GO:0140056	0.311	organelle localization by membrane tethering
GO:0010468	0.308	regulation of gene expression
GO:0009892	0.306	negative regulation of metabolic process
GO:0044093	0.305	positive regulation of molecular function
GO:0008333	0.301	endosome to lysosome transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0035032	0.999	phosphatidylinositol 3-kinase complex, class III
GO:0012505	0.995	endomembrane system
GO:0005829	0.993	cytosol
GO:0031090	0.973	organelle membrane
GO:0098588	0.964	bounding membrane of organelle
GO:0031410	0.957	cytoplasmic vesicle
GO:0005773	0.951	vacuole
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0005634	0.714	nucleus
GO:0042175	0.674	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005776	0.669	autophagosome
GO:0098827	0.667	endoplasmic reticulum subcompartment
GO:0005789	0.663	endoplasmic reticulum membrane
GO:0000407	0.646	phagophore assembly site
GO:0031981	0.588	nuclear lumen
GO:0005654	0.552	nucleoplasm
GO:0005856	0.534	cytoskeleton
GO:0030139	0.505	endocytic vesicle
GO:0005774	0.499	vacuolar membrane
GO:0097629	0.389	extrinsic component of omegasome membrane
GO:0045335	0.388	phagocytic vesicle
GO:0042995	0.387	cell projection
GO:0034045	0.386	phagophore assembly site membrane
GO:0120025	0.382	plasma membrane bounded cell projection
GO:0097632	0.379	extrinsic component of phagophore assembly site membrane
GO:0005768	0.368	endosome
GO:0005929	0.364	cilium
GO:0071944	0.343	cell periphery
GO:0000421	0.340	autophagosome membrane
GO:0000323	0.327	lytic vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]