StarFunc result for job id Q6ZNI0

User Input

>input (430 residues)
MSQLRATKSGLVVRAVICIFIFLYLRNPTPAESEEEPAQPEVVECGFYPDELCSALFEGK
GAAPQIAKFCKTPHKSEIHAHLHTPGNCSRISRGLHFITRPLSAEEGDFSLAYIITIHKE
LAMFVQLLRAIYVPQNVYCIHVDEKAPMKYKTAVQTLVNCFENVFISSKTEKVAYAGFTR
LQADINCMKVLVHSKFQWNYVINLCGQDFPIKTNREIIHYIRSKWSDKNITPGVIQPLHI
KSKTSQSHLEFVPKGSIYAPPNNRFKDKPPHNLTIYFGSAYYVLTRKFVEFILTDIHAKD
MLQWSKDIRSPEQHYWVTLNRLKDAPGATPNAGWEGNVRAIKRKSEEGNVHDGCKGRYVE
DICVYGPGDLPWLIQSPSLFANKFEPSTDPLVVTCLERRHRLQVLRQAEVPIEPHWHFQQ
QSHFNMRLNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N0V5	0.741	0.791	2.587E-44	402	0.447	0.478	Q8N0V5.pdb.gz	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
2	AFDB:Q6T5E1	0.749	0.804	1.281E-43	400	0.451	0.485	Q6T5E1.pdb.gz	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
3	AFDB:Q6T5D9	0.760	0.816	1.687E-43	400	0.433	0.465	Q6T5D9.pdb.gz	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
4	AFDB:P97402	0.772	0.826	1.910E-42	401	0.433	0.464	P97402.pdb.gz	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
5	AFDB:Q5JCT0	0.712	0.701	2.932E-35	437	0.330	0.325	Q5JCT0.pdb.gz	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
6	AFDB:Q09324	0.717	0.720	1.043E-34	428	0.319	0.320	Q09324.pdb.gz	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
7	AFDB:O95395	0.702	0.689	1.913E-34	438	0.335	0.329	O95395.pdb.gz	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
8	AFDB:Q02742	0.702	0.705	2.973E-34	428	0.305	0.306	Q02742.pdb.gz	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
9	AFDB:E9Q649	0.711	0.674	6.090E-34	455	0.328	0.310	E9Q649.pdb.gz	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
10	AFDB:Q9P109	0.712	0.678	9.468E-34	453	0.316	0.300	Q9P109.pdb.gz	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
11	PDB:2gamC	0.721	0.824	1.142E-31	374	0.300	0.345	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
12	PDB:6fxrA	0.260	0.172	1.263E-4	700	0.063	0.039	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4hg6A	0.213	0.132	5.915E-4	747	0.084	0.048	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
14	PDB:7x8kB	0.235	0.266	6.250E-4	367	0.081	0.095	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
15	PDB:7jhiC	0.382	0.474	1.212E-3	331	0.074	0.097	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
16	PDB:6qg2F	0.214	0.241	2.222E-3	375	0.047	0.053	6qg2F.pdb.gz	Structural basis for the inhibition of translation through eIF2 alpha phosphorylation.
17	PDB:4y63A	0.249	0.344	2.348E-3	282	0.065	0.099	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
18	PDB:5a07A	0.182	0.194	3.094E-3	395	0.060	0.066	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
19	PDB:4d0tA	0.228	0.202	4.552E-3	496	0.035	0.030	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
20	PDB:6h0bB	0.259	0.217	5.083E-3	521	0.072	0.060	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6T5E1	1.81e-129	381	400	0.416	0.448	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
2	Q6T5D9	3.89e-129	380	400	0.412	0.443	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
3	Q6T5E0	9.86e-127	374	400	0.412	0.443	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
4	P97402	1.14e-124	369	401	0.437	0.469	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
5	Q8N0V5	2.18e-123	365	402	0.423	0.453	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
6	O95395	1.44e-82	262	438	0.307	0.301	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
7	Q09324	1.58e-79	254	428	0.307	0.308	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
8	Q5JCT0	2.48e-78	251	437	0.302	0.297	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
9	Q8CH87	5.85e-78	250	437	0.295	0.291	GCNT3_RAT Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1
10	Q64165	1.06e-77	249	428	0.302	0.304	Q64165_RAT Glucosaminyl (N-acetyl) transferase 1 OS=Rattus norvegicus OX=10116 GN=Gcnt1 PE=4 SV=1
11	Q9P109	2.79e-76	246	453	0.286	0.272	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
12	E9Q649	1.75e-75	244	455	0.284	0.268	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
13	Q02742	8.34e-75	241	428	0.288	0.290	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
14	Q7KVA1	1.87e-17	87.4	876	0.188	0.092	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
15	D3J0E7	2.87e-16	83.6	919	0.179	0.084	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
16	Q9EPL0	5.50e-16	82.8	865	0.181	0.090	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
17	Q811B1	3.36e-14	77.0	953	0.167	0.076	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
18	Q9EPI1	1.81e-13	74.7	821	0.165	0.086	XYLT1_RAT Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
19	Q9H1B5	2.04e-13	74.7	865	0.172	0.086	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
20	Q9LE60	5.82e-13	72.4	424	0.130	0.132	Q9LE60_ARATH AT3g15350/K7L4_15 OS=Arabidopsis thaliana OX=3702 GN=At3g15350 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	4.6e-42	155.8	Core-2/I-Branching enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321874	0.931	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
2	9606.ENSP00000389176	0.931	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
3	9606.ENSP00000414350	0.918	Mucin-20
4	9606.ENSP00000406861	0.912	Mucin-6
5	9606.ENSP00000417498	0.910	Mucin-4
6	9606.ENSP00000368771	0.906	Mucin-3A
7	9606.ENSP00000381008	0.905	Mucin-16
8	9606.ENSP00000416753	0.905	Mucin-15
9	9606.ENSP00000485659	0.905	Mucin-5AC
10	9606.ENSP00000436812	0.904	Mucin-5B
11	9606.ENSP00000485028	0.904	Mucin-13
12	9606.ENSP00000302716	0.902	Mucin-17
13	9606.ENSP00000484824	0.902	Mucin-1
14	9606.ENSP00000441929	0.901	Mucin-12
15	9606.ENSP00000311364	0.900	Mucin-like protein 1
16	9606.ENSP00000365473	0.900	Mucin-21
17	9606.ENSP00000407422	0.900	Mucin-7
18	9606.ENSP00000217109	0.652	Cleavage stimulation factor subunit 1
19	9606.ENSP00000353462	0.603	Cas scaffolding protein family member 4
20	9606.ENSP00000064571	0.586	Cerebellin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0140096	0.966	catalytic activity, acting on a protein
GO:0140103	0.826	catalytic activity, acting on a glycoprotein
GO:0005488	0.821	binding
GO:0005515	0.798	protein binding
GO:0008109	0.508	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity
GO:0003829	0.443	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0008152	0.673	metabolic process
GO:0065007	0.663	biological regulation
GO:0071704	0.572	organic substance metabolic process
GO:0050789	0.533	regulation of biological process
GO:0070085	0.520	glycosylation
GO:0050794	0.506	regulation of cellular process
GO:0044238	0.499	primary metabolic process
GO:0006807	0.455	nitrogen compound metabolic process
GO:0043170	0.454	macromolecule metabolic process
GO:0044237	0.451	cellular metabolic process
GO:1901564	0.409	organonitrogen compound metabolic process
GO:0019538	0.403	protein metabolic process
GO:0050896	0.317	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0012505	0.983	endomembrane system
GO:0005794	0.967	Golgi apparatus
GO:0005886	0.775	plasma membrane
GO:0070013	0.544	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:17413	0.508	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.150	0.508	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase.
RHEA:18705	0.443	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP
EC:2.4.1.102	0.443	acetylglucosaminyltransferase.

[back to server]