StarFunc result for job id Q6ZNJ1

User Input

>input (1400 residues)
MAASERLYELWLLYYAQKDLGYLQQWLKAFVGAFKKSISLSSLEPRRPEEAGAEVPLLPL
DELHVLAEQLHQADLEQALLLLKLFIILCRNLENIEAGRGQVLVPRVLALLTKLVAELKG
CPPPQGRGTQLENVALHALLLCEGLFDPYQTWRRQRSGEVISSKEKSKYKFPPAALPQEF
SAFFQESLQNADHLPPILLLRLIHLFCAVLAGGKENGQMAVSDGSVKGLLSVVRGWSRGP
APDPCLVPLALEALVGAVHVLHASRAPPRGPELRALLESYFHVLNADWPAGLSSGPEEAL
VTLRVSMLDAIPMMLACEDRPVLQATFLSNNCFEHLTRLIQNSKLYLQSRAPPEGDSDLA
TRLLTEPDVQKVLDQDTDAIAVHVVRVLTCIMSDSPSAKEVFKERIGYPHLQEVLQSHGP
PTHRLLQELLNMAVEGDHSMCPPPPIRNEQPVLVLAQWLPSLPTAELRLFLAQRLRWLCD
SCPASRATCVQAGLVGCLLETLSTGLALEARCQEQLLALLQALGRVSIRPMELRHLLRPR
PGLDSEPGGAEAGKARHAGAVIRTLSGMARHQGPARALRYFDLTPSMAGIMVPPVQRWPG
PGFTFHAWLCLHPMDTAPTPAPTRPLQRKQLYSFFTSSGSGFEAFFTAAGTLVVAVCTRK
EYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLVHVYKDGHLVKTAPLRCPSLSEPFS
SCCIGSAGYRTTTTTTGLPTPPVPATLAYTHPALTRSQSVPASTGLGWGSGLVAPLQEGS
IDSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQATALRTLCTLGPNETAPFKPEGELHE
LSTRLLLHYSPQACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVNCVGGMGALLPLLE
RVAAQPKEAEAGPAETHDLVGPELTSGHNTQGLVLPLGKSSEERMERNAVAAFLLMLRNF
LQGHMVNQESLVQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAEGSGPLLYLLY
QHLLFNFHLWTLSDFAVRLGHIQYMSSIVREHRQKLRKKYGVQFILDALRTHYSPQRERP
LAADDLRTVQTSLLGLAREFLVRSLSADDVQVTQTMLSFLAATGDDGQAVGALDLLLALL
HGSLVQESLAVFLLEPGNLEVLLALLVRPGSLPLLPDRVCKILRRLQQNERLPERSRQRL
RLRECGLQGLVACLPEGTVSPQLCQGLYKLFLGADCLNLSDLLAVVQLSLQADLSVRLDI
CRQLFHLIYGQPDVVRLLARQAGWQDVLTRLYVLEAATAGSPPPSSPESPTSPKPAPPKP
PTESPAEPSDVFLPSEAPCPDPDGFYHALSPFCTPFDLGLERSSVGSGNTAGGGGSSGTL
TPASQPGTPSPLDGPRPFPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7unkA	0.174	0.218	3.322E-6	1047	0.106	0.142	7unkA.pdb.gz
2	AFDB:Q5UIP0	0.237	0.161	7.342E-6	2472	0.111	0.063	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
3	AFDB:Q6PR54	0.231	0.158	2.105E-5	2419	0.107	0.062	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	PDB:7mopA	0.136	0.091	3.491E-5	2445	0.133	0.076	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
5	PDB:6xu2A	0.126	0.153	4.310E-5	1091	0.094	0.120	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
6	PDB:3w3uA	0.166	0.209	7.045E-5	1030	0.104	0.142	3w3uA.pdb.gz
7	AFDB:Q8RWY6	0.109	0.107	7.193E-5	1439	0.123	0.120	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
8	AFDB:F4HRS2	0.152	0.109	1.135E-4	2222	0.111	0.070	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
9	AFDB:P29539	0.140	0.115	1.135E-4	1916	0.104	0.076	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
10	PDB:2xwuB	0.165	0.228	1.325E-4	910	0.089	0.137	2xwuB.pdb.gz
11	PDB:7t3pA	0.114	0.090	2.020E-4	2066	0.089	0.060	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
12	PDB:3w3zA	0.170	0.219	2.092E-4	1013	0.106	0.147	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
13	PDB:7jq9A	0.154	0.103	2.167E-4	2427	0.129	0.074	7jq9A.pdb.gz
14	PDB:6vaeA	0.115	0.128	2.494E-4	1198	0.125	0.146	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
15	PDB:5hb4B	0.159	0.160	2.583E-4	1388	0.116	0.117	5hb4B.pdb.gz
16	AFDB:Q7TPV4	0.116	0.118	3.880E-4	1344	0.125	0.130	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
17	AFDB:Q96UP3	0.219	0.219	6.569E-4	1400	0.103	0.103	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
18	AFDB:Q498H0	0.131	0.128	1.526E-3	1448	0.121	0.117	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
19	AFDB:Q61037	0.105	0.087	2.870E-3	1814	0.119	0.092	Q61037.pdb.gz	TSC2_MOUSE Tuberin OS=Mus musculus OX=10090 GN=Tsc2 PE=1 SV=1
20	AFDB:B5X0I6	0.132	0.151	3.303E-3	1091	0.096	0.124	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FAW3	0.0	1147	2801	0.478	0.239	NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio OX=7955 GN=nbeal2 PE=1 SV=1
2	Q6ZNJ1	0.0	2828	2754	1.000	0.508	NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2
3	Q6ZQA0	0.0	2276	2742	0.865	0.442	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
4	F4I9T0	1.93e-20	101	2604	0.079	0.043	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
5	Q19317	1.33e-15	85.5	2507	0.124	0.069	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
6	Q9ESE1	1.19e-14	82.4	2856	0.108	0.053	LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1
7	P50851	1.21e-14	82.4	2863	0.109	0.053	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
8	E7EZD1	1.53e-14	82.0	2998	0.111	0.052	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
9	Q9EPN1	6.09e-14	80.1	2936	0.118	0.056	NBEA_MOUSE Neurobeachin OS=Mus musculus OX=10090 GN=Nbea PE=1 SV=1
10	Q9W4E2	3.35e-10	67.8	3466	0.042	0.017	NBEA_DROME Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4
11	Q54RQ8	2.07e-07	58.5	2192	0.042	0.027	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
12	F4JD14	1.14e-06	55.8	1941	0.035	0.025	BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana OX=3702 GN=BCHC1 PE=1 SV=1
13	Q54VJ6	0.017	42.0	462	0.017	0.052	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
14	Q55AV3	0.055	40.8	2967	0.025	0.012	LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum OX=44689 GN=lvsD PE=4 SV=2
15	E9Q2M9	0.22	38.5	3183	0.046	0.020	WDFY4_MOUSE WD repeat- and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Wdfy4 PE=1 SV=2
16	Q9Z351	0.35	37.7	759	0.019	0.034	KCNQ2_MOUSE Potassium voltage-gated channel subfamily KQT member 2 OS=Mus musculus OX=10090 GN=Kcnq2 PE=1 SV=1
17	F4JHT3	0.68	37.0	3527	0.048	0.019	BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana OX=3702 GN=BCHA2 PE=4 SV=1
18	Q12955	0.76	37.0	4377	0.013	0.004	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
19	P69735	1.2	36.2	775	0.019	0.035	RB3GP_RAT Rab3 GTPase-activating protein catalytic subunit (Fragments) OS=Rattus norvegicus OX=10116 GN=Rab3gap1 PE=1 SV=2
20	Q8NEZ4	1.8	35.8	4911	0.018	0.005	KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15787 DUF4704	2.4e-23	94.3	Neurobeachin/BDCP, DUF4704 alpha solenoid region
2	PF13385 Laminin_G_3	22	16.6	Concanavalin A-like lectin/glucanases superfamily
3	PF20425 Neurobeachin	1.4e-07	42.4	Neurobeachin alpha solenoid region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415034

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365107	0.766	Serine/threonine-protein kinase greatwall
2	9606.ENSP00000452181	0.693	Spermatogenesis-defective protein 39 homolog
3	9606.ENSP00000327650	0.681	Vacuolar protein sorting-associated protein 33B
4	9606.ENSP00000323046	0.679	Exosome complex component RRP40
5	9606.ENSP00000306410	0.675	Armadillo repeat-containing protein 4
6	9606.ENSP00000361548	0.638	Thrombopoietin receptor
7	9606.ENSP00000231749	0.615	Zinc finger MYND domain-containing protein 10
8	9606.ENSP00000263686	0.597	P-selectin
9	9606.ENSP00000463058	0.591	RNA-binding protein 8A
10	9606.ENSP00000292314	0.553	Coiled-coil domain containing 12
11	9606.ENSP00000262407	0.538	Integrin alpha-IIb
12	9606.ENSP00000207549	0.528	Protein unc-13 homolog D
13	9606.ENSP00000278980	0.524	COMM domain-containing protein 7
14	9606.ENSP00000344782	0.517	Zinc finger protein Gfi-1b
15	9606.ENSP00000405708	0.517	Coiled-coil domain-containing protein 39
16	9606.ENSP00000420477	0.517	NAC-alpha domain-containing protein 1
17	9606.ENSP00000356430	0.516	Regulator of G-protein signaling 18
18	9606.ENSP00000418983	0.505	Uncharacterized protein C6orf222

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030099	0.998	myeloid cell differentiation
GO:0000904	0.873	cell morphogenesis involved in differentiation
GO:0065007	0.688	biological regulation
GO:0048646	0.663	anatomical structure formation involved in morphogenesis
GO:0032501	0.397	multicellular organismal process
GO:0050896	0.367	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030141	0.997	secretory granule
GO:0012506	0.995	vesicle membrane
GO:0005886	0.994	plasma membrane
GO:0098588	0.994	bounding membrane of organelle
GO:0030659	0.990	cytoplasmic vesicle membrane
GO:0070820	0.988	tertiary granule
GO:0030667	0.977	secretory granule membrane
GO:0005783	0.957	endoplasmic reticulum
GO:0101002	0.957	ficolin-1-rich granule
GO:0070821	0.929	tertiary granule membrane
GO:0101003	0.927	ficolin-1-rich granule membrane
GO:0005634	0.336	nucleus
GO:0005829	0.321	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]