StarFunc result for job id Q6ZNL6

User Input

>input (1462 residues)
MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLPCVDRGLDEGPRSIPKCSESE
TDEDYIVVPRVPLREDEPKDEGSVGNKALVSPESSAEEEEEREEGGEACGLEGTGAGEDS
VAPAAPGAGALSREGEEGTDLALEDEGEGCADEPGTLEQVSRSEEEEKLVQPHRECSLED
SGPWAGEGVFQSDLLLPHIHGEDQEPPDTPGEAEEDDEEGCASTDPAGADEGSGPDRPTE
DMGQDAEDTSEEPPEKEELAGVQEAETATDCPEVLEEGCEEATGVTGGEQVDLSEPPDHE
KKTNQEVAAATLEDHAQDESAEESCQIVPFENDCMEDFVTSLTGSPYEFFPTESTSFCSE
SCSPLSESAKGLESEQAPKLGLRAEENPMVGALCGQCGSLQGGAAEGPAAPDVVVVLEEE
ALDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEELNCEAEGGLVPADRKNTST
RVRPHSGKVAGYVPETVPEETGPEAGSSAPGIGGAAEEVGKTLLSLEGKPLEASRALPAK
PRAFTLYPRSFSVEGREIPVSVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNH
LPSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIESDSPDKYKKKKSSFKRFLALT
FKKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPS
SLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAM
NSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDA
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQEL
LSSEKAYVEMLQHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGIL
EELEERLSNWESQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVRE
FEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR
ANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVL
LYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
CLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLR
RHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSF
PLSSPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHW
KKLWFVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYS
FKAEDTNSAQRWIEAMEDASVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZNL6	1.000	1.000	0.000	1462	1.000	1.000	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
2	AFDB:Q96PE2	0.121	0.087	1.793E-18	2063	0.190	0.135	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
3	AFDB:Q12774	0.099	0.093	9.439E-16	1597	0.150	0.138	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
4	AFDB:E9Q7D5	0.107	0.099	3.114E-15	1581	0.147	0.136	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
5	AFDB:M9PHU0	0.133	0.089	6.900E-15	2263	0.162	0.105	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
6	PDB:7rx9A	0.169	0.480	5.426E-14	432	0.049	0.164	7rx9A.pdb.gz
7	PDB:4mt6A	0.127	0.411	1.467E-13	389	0.038	0.144	4mt6A.pdb.gz
8	AFDB:X2JC00	0.127	0.132	1.583E-13	1404	0.109	0.113	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
9	AFDB:Q9VW85	0.122	0.108	2.322E-12	1661	0.153	0.134	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
10	AFDB:M9PC26	0.079	0.061	2.617E-10	2021	0.149	0.108	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
11	PDB:4gouA	0.135	0.309	3.928E-9	507	0.033	0.095	4gouA.pdb.gz
12	AFDB:Q9VGI1	0.080	0.084	1.146E-8	1354	0.116	0.125	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
13	AFDB:Q9VZ85	0.120	0.091	3.099E-8	1984	0.157	0.116	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
14	PDB:3ljuX	0.063	0.231	2.099E-7	373	0.030	0.118	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:6bbpA	0.064	0.169	2.251E-5	520	0.027	0.075	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:5yqrA	0.067	0.310	2.613E-5	268	0.021	0.112	5yqrA.pdb.gz
17	PDB:6u3eA	0.088	0.250	7.804E-5	397	0.034	0.126	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:4mk0A	0.066	0.142	2.008E-4	631	0.019	0.044	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3pvuA	0.064	0.144	7.316E-4	609	0.025	0.061	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:6hhgA	0.058	0.206	1.089E-3	386	0.014	0.054	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2X0SFF2	0.0	2996	1462	1.000	1.000	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
2	B7ZM68	0.0	2397	1178	0.806	1.000	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
3	Q6ZNL6	0.0	2996	1462	1.000	1.000	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
4	H7C0G2	2.38e-168	506	252	0.172	0.996	H7C0G2_HUMAN FYVE, RhoGEF and PH domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
5	Q96M96	1.48e-64	237	766	0.117	0.223	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
6	Q91ZT5	9.59e-64	235	766	0.109	0.209	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
7	O88387	1.12e-62	231	766	0.107	0.205	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
8	Q7Z6J4	5.26e-55	206	655	0.116	0.260	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
9	P98174	1.52e-54	209	961	0.110	0.168	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
10	P52734	3.10e-54	209	960	0.109	0.167	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
11	Q49A55	1.63e-53	197	471	0.077	0.238	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
12	Q8BY35	5.98e-48	185	655	0.107	0.238	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
13	O88842	5.58e-45	177	733	0.111	0.221	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
14	Q5JSP0	4.36e-44	174	725	0.107	0.217	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
15	Q91VS8	1.13e-32	140	1065	0.067	0.092	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
16	G5ECM5	1.40e-28	127	826	0.089	0.157	G5ECM5_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-5 PE=1 SV=1
17	Q9Y4F1	2.99e-28	126	1045	0.068	0.095	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
18	F1LYQ8	7.47e-28	125	1049	0.066	0.092	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
19	G5ED03	8.23e-28	124	844	0.088	0.152	G5ED03_CAEEL Putative Rho guanine nucleotide exchange factor FGD-1 OS=Caenorhabditis elegans OX=6239 GN=fgd-1 PE=2 SV=1
20	O94887	2.22e-27	123	1054	0.065	0.090	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	1.2e-10	52.7	FYVE zinc finger
2	PF02318 FYVE_2	8.5e+02	11.5	FYVE-type zinc finger
3	PF13012 MitMem_reg	91	14.9	Maintenance of mitochondrial structure and function
4	PF03574 Peptidase_S48	3.3	19.3	Peptidase family S48
5	PF00169 PH	2.8e-14	64.9	PH domain
6	PF16652 PH_13	0.16	23.3	Pleckstrin homology domain
7	PF15410 PH_9	50	15.5	Pleckstrin homology domain
8	PF00621 RhoGEF	4.1e-24	97.3	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355026	0.593	Rho guanine nucleotide exchange factor 15
2	9606.ENSP00000248706	0.516	Ras-like protein family member 11B
3	9606.ENSP00000310303	0.505	Testis- and ovary-specific PAZ domain-containing protein 1
4	9606.ENSP00000379880	0.501	Leucine-rich repeat-containing protein 3B
5	9606.ENSP00000439625	0.501	Pleckstrin homology domain-containing family G member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.506	enzyme binding
GO:0051020	0.485	GTPase binding
GO:0031267	0.472	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051056	0.993	regulation of small GTPase mediated signal transduction
GO:0009987	0.621	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	0.986	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]