StarFunc result for job id Q6ZNX1

User Input

>input (250 residues)
MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVI
SEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQ
SEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQT
LEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLF
VHKYGVIFSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZNX1	1.000	1.000	2.264E-47	250	1.000	1.000	Q6ZNX1.pdb.gz	SHLD3_HUMAN Shieldin complex subunit 3 OS=Homo sapiens OX=9606 GN=SHLD3 PE=1 SV=1
2	AFDB:Q8CI78	0.181	0.114	6.066E-2	450	0.148	0.082	Q8CI78.pdb.gz	RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus OX=10090 GN=Rmnd1 PE=1 SV=1
3	AFDB:Q9LYE3	0.168	0.079	1.439E-1	650	0.144	0.055	Q9LYE3.pdb.gz	ASI1_ARATH Protein ANTI-SILENCING 1 OS=Arabidopsis thaliana OX=3702 GN=ASI1 PE=1 SV=2
4	PDB:3uwxA	0.215	0.073	1.657E-1	945	0.064	0.017	3uwxA.pdb.gz	Structure and mechanism of the UvrA-UvrB DNA damage sensor.
5	AFDB:Q86AT9	0.103	0.026	2.084E-1	1736	0.116	0.017	Q86AT9.pdb.gz	DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum OX=44689 GN=dhkI-1 PE=3 SV=1
6	AFDB:F4JA39	0.085	0.054	3.018E-1	558	0.116	0.052	F4JA39.pdb.gz	F4JA39_ARATH SLH domain protein OS=Arabidopsis thaliana OX=3702 GN=At3g25680 PE=1 SV=1
7	PDB:6bm7E	0.184	0.166	3.475E-1	291	0.044	0.038	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
8	AFDB:Q03735	0.132	0.044	3.632E-1	1134	0.144	0.032	Q03735.pdb.gz	NAB6_YEAST RNA-binding protein NAB6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAB6 PE=1 SV=1
9	AFDB:Q53L62	0.179	0.109	4.109E-1	458	0.128	0.070	Q53L62.pdb.gz	Q53L62_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os11g15210 PE=3 SV=1
10	PDB:5me5A	0.218	0.331	4.448E-1	152	0.056	0.092	5me5A.pdb.gz
11	AFDB:Q21351	0.229	0.141	5.594E-1	473	0.132	0.070	Q21351.pdb.gz	Q21351_CAEEL Ras-Gtpase-activating protein SH3 (Three) domain-Binding Protein OS=Caenorhabditis elegans OX=6239 GN=gtbp-1 PE=1 SV=2
12	PDB:1wsvA	0.187	0.132	6.442E-1	371	0.040	0.027	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
13	PDB:7o4iO	0.191	0.245	7.752E-1	181	0.048	0.066	7o4iO.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:7c79B	0.196	0.071	8.770E-1	793	0.068	0.021	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
15	AFDB:F4IEC7	0.156	0.109	9.166E-1	406	0.140	0.086	F4IEC7.pdb.gz	F4IEC7_ARATH CTC-interacting domain 11 OS=Arabidopsis thaliana OX=3702 GN=CID11 PE=1 SV=1
16	PDB:3ociB	0.181	0.233	9.922E-1	180	0.048	0.067	3ociB.pdb.gz
17	PDB:1vokA	0.180	0.221	1.055	192	0.048	0.062	1vokA.pdb.gz
18	AFDB:Q6DRG1	0.147	0.105	1.103	402	0.152	0.095	Q6DRG1.pdb.gz	RBM42_DANRE RNA-binding protein 42 OS=Danio rerio OX=7955 GN=rbm42 PE=2 SV=2
19	PDB:1a0gB	0.097	0.086	1.194	282	0.032	0.028	1a0gB.pdb.gz	Crystal structures of L201A mutant of D-amino acid aminotransferase at 2.0 A resolution: implication of the structural role of Leu201 in transamination.
20	PDB:7bfqB	0.163	0.085	1.194	590	0.064	0.027	7bfqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZNX1	0.0	521	250	1.000	1.000	SHLD3_HUMAN Shieldin complex subunit 3 OS=Homo sapiens OX=9606 GN=SHLD3 PE=1 SV=1
2	P23257	6.3	30.4	475	0.072	0.038	TBG1_DROME Tubulin gamma-1 chain OS=Drosophila melanogaster OX=7227 GN=gammaTub23C PE=1 SV=2
3	O75592	8.0	30.4	4678	0.116	0.006	MYCB2_HUMAN E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4
4	A0A499FJI4	8.3	30.4	4738	0.116	0.006	A0A499FJI4_HUMAN RCR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=2
5	Q964D8	8.5	30.0	391	0.088	0.056	BUP1_DICDI Beta-ureidopropionase OS=Dictyostelium discoideum OX=44689 GN=pyd3 PE=1 SV=1
6	Q8VCK3	8.9	30.0	451	0.064	0.035	TBG2_MOUSE Tubulin gamma-2 chain OS=Mus musculus OX=10090 GN=Tubg2 PE=1 SV=1
7	Q1LU99	9.2	30.0	1083	0.060	0.014	RIPR2_DANRE Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1
8	P57722	9.3	30.0	371	0.068	0.046	PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus OX=10090 GN=Pcbp3 PE=1 SV=3
9	P83887	9.6	30.0	451	0.064	0.035	TBG1_MOUSE Tubulin gamma-1 chain OS=Mus musculus OX=10090 GN=Tubg1 PE=1 SV=1
10	P83888	9.6	30.0	451	0.064	0.035	TBG1_RAT Tubulin gamma-1 chain OS=Rattus norvegicus OX=10116 GN=Tubg1 PE=2 SV=1
11	Q54HI5	9.8	30.0	716	0.056	0.020	LMNB1_DICDI Lamin-like protein OS=Dictyostelium discoideum OX=44689 GN=lmnB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01609 DDE_Tnp_1	55	14.9	Transposase DDE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298784	0.990	Protein FAM35A
2	9606.ENSP00000235310	0.953	Mitotic spindle assembly checkpoint protein MAD2B
3	9606.ENSP00000305875	0.910	Uncharacterized protein C20orf196
4	9606.ENSP00000409231	0.827	Belongs to the TRAPPC13 family
5	9606.ENSP00000371475	0.641	TP53-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0010604	0.986	positive regulation of macromolecule metabolic process
GO:0048522	0.985	positive regulation of cellular process
GO:0051173	0.985	positive regulation of nitrogen compound metabolic process
GO:0050871	0.983	positive regulation of B cell activation
GO:0002639	0.983	positive regulation of immunoglobulin production
GO:0010569	0.983	regulation of double-strand break repair via homologous recombination
GO:0045911	0.983	positive regulation of DNA recombination
GO:0045910	0.983	negative regulation of DNA recombination
GO:0002891	0.983	positive regulation of immunoglobulin mediated immune response
GO:2000781	0.983	positive regulation of double-strand break repair
GO:2001021	0.982	negative regulation of response to DNA damage stimulus
GO:0051094	0.978	positive regulation of developmental process
GO:2000042	0.485	negative regulation of double-strand break repair via homologous recombination
GO:0045830	0.485	positive regulation of isotype switching
GO:2001034	0.465	positive regulation of double-strand break repair via nonhomologous end joining
GO:0009987	0.417	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035861	1.000	site of double-strand break
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0043233	0.954	organelle lumen
GO:0070013	0.937	intracellular organelle lumen
GO:0005737	0.928	cytoplasm
GO:0005634	0.893	nucleus
GO:0031981	0.785	nuclear lumen
GO:0005654	0.544	nucleoplasm
GO:0032991	0.473	protein-containing complex
GO:0005829	0.418	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]