StarFunc result for job id Q6ZP01

User Input

>input (1052 residues)
MMQATAVVETASGKGYHSNGGNLQKDKPSNPKKENLLLSSNGCDEVKLTFPDDDWNSSTL
EQRANNKEISNIDKMDLLEPFFSVSQDTNTESTQFQSSELEDSTDYAFLNKTYSIPYSES
KLKKESLTPLSSELDPEVQKKEEVFFNILEHQDKTVGLERIYNISDANYRESAEDTQKHD
TDEDSQQEYHSAEEQEYISNHLSFDQTKALDISNPEVVELGNSGYEVKCASNVEDNRVNS
GSGSIISFDSLDVYGQEESLHVSKFQNSVMLREYHDLKHEKYKEQETNSMYHTVFDGSVL
RSNSPGNQESQSKSGSLSPQKVLKMKIYTENMKSQINEGKDFCGNKIVENKILLHLENPS
TLPQDKALETLLQPCKDCQTSWTSVFDDSIISACGYYESLQNTADSALDFSAMLPKIAVR
DNQAIEDNTSLKVAHSSTTKKTCFHNIGEMCTKSLTDAASCTVTINQTVDVSTDFRACFT
TSRATSARPSVVSTSSNTEITMMNKKRPDEWQNEKQKSVACSTDWSYSEDCIDTQMAITK
GSGKSLSVDSLKPNGNFLNKDFLELRKACGITDLKKHPEREFQLFKDTEKDLPSMCCQKI
MQRAIKAELHLLNVHYQMCRRHCCDIYKLVMENREGLNMNLSSNSAKKELGSALLSLLGD
LKVRYVTLKEKIHKGIPLEELPPLSLESKLLSTFSTFASRLMKKETHVFSEADAEQDNQR
AHDVDVSSNLKKTLSQMSLSSDNSHATQNISPKKDDFKNGDINADFSQLKLGDKDCRHYQ
ETSEDWSDAKESLTGVDVSGTQGNQVEQDTWNLDLTGEMKNVEPSQRDKGYLIHVGGLCP
SVSEADLRSHFQKYQVSEISIYDSTNYRYASLAFTKNSDAKIAVKEMNGIEINGKSVNVW
PVKILGEYTSPLSSKNGNRISSNNLEKSTNKQIHSEFSISRLPRTRPRQLGSEQDSEVFP
SDQGVKKNCKQIESAKLLPDTPVQFIPPNTLNLRSFTKIIKRLAELHPEVSRDHIINALQ
EVRIRHKGFLNGLSITTIVEMTSSLLKNSASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3V089	0.227	0.235	5.116E-80	1013	0.552	0.574	Q3V089.pdb.gz	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
2	AFDB:Q9VED3	0.054	0.049	6.194E-7	1186	0.134	0.119	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
3	PDB:5xjcw	0.074	0.765	8.508E-6	91	0.018	0.209	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
4	PDB:3lqvB	0.065	0.559	1.546E-5	115	0.013	0.122	3lqvB.pdb.gz	Branch Recognition by SF3b14
5	AFDB:J9VE33	0.044	0.043	1.556E-5	1094	0.125	0.121	J9VE33.pdb.gz	CRZ1_CRYNH Transcriptional regulator CRZ1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CRZ1 PE=1 SV=1
6	PDB:7dvqY	0.068	0.465	1.849E-5	140	0.022	0.164	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
7	AFDB:D3ZRA6	0.078	0.056	1.975E-5	1683	0.161	0.100	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
8	PDB:1hl6A	0.070	0.576	3.164E-5	119	0.017	0.151	1hl6A.pdb.gz
9	PDB:7oqcF	0.070	0.261	3.164E-5	267	0.024	0.094	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
10	AFDB:Q9M1S4	0.072	0.092	4.043E-5	792	0.116	0.154	Q9M1S4.pdb.gz	Q9M1S4_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=T5N23_120 PE=1 SV=1
11	PDB:5yzg1	0.062	0.258	4.264E-5	243	0.019	0.082	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:5gm6V	0.066	0.500	5.100E-5	128	0.015	0.125	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6qx91K	0.069	0.343	7.746E-5	201	0.018	0.095	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	AFDB:Q8SY33	0.078	0.067	7.797E-5	1384	0.124	0.094	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
15	AFDB:Q6AI39	0.050	0.049	9.326E-5	1079	0.145	0.142	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
16	PDB:5lsbA	0.066	0.379	9.835E-5	176	0.013	0.080	5lsbA.pdb.gz
17	AFDB:Q15424	0.051	0.057	1.184E-4	915	0.114	0.131	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
18	AFDB:Q54I36	0.047	0.038	1.596E-4	1338	0.123	0.096	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
19	PDB:6gd1A	0.068	0.359	1.787E-4	190	0.014	0.079	6gd1A.pdb.gz
20	AFDB:Q8IRB5	0.040	0.032	1.798E-4	1465	0.147	0.106	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V089	0.0	1025	1013	0.554	0.576	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
2	Q9NW64	0.003	43.9	420	0.027	0.067	RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22 PE=1 SV=1
3	Q93194	0.005	42.7	312	0.022	0.074	Q93194_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnp-9 PE=4 SV=4
4	Q9U2F5	0.054	39.7	434	0.024	0.058	Q9U2F5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tiar-2 PE=1 SV=1
5	P48809	0.070	39.3	421	0.025	0.062	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
6	Q62029	0.091	39.3	628	0.034	0.057	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
7	Q6NZZ9	0.091	38.9	425	0.020	0.049	RBM22_DANRE Pre-mRNA-splicing factor RBM22 OS=Danio rerio OX=7955 GN=rbm22 PE=2 SV=1
8	Q3V2M1	0.100	38.5	266	0.034	0.135	Q3V2M1_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pabpc2 PE=2 SV=1
9	E5RJB9	0.14	36.2	129	0.035	0.287	E5RJB9_HUMAN Polyadenylate-binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
10	O45713	0.16	35.0	85	0.023	0.282	O45713_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbm-3.2 PE=1 SV=1
11	P53316	0.18	38.1	781	0.023	0.031	YG5B_YEAST Uncharacterized RNA-binding protein YGR250C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR250C PE=1 SV=1
12	P62995	0.22	37.4	288	0.026	0.094	TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
13	P62996	0.22	37.4	288	0.026	0.094	TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus OX=10090 GN=Tra2b PE=1 SV=1
14	P62997	0.22	37.4	288	0.026	0.094	TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus OX=10116 GN=Tra2b PE=1 SV=1
15	Q00539	0.22	37.7	523	0.023	0.046	NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM8 PE=1 SV=2
16	Q19579	0.23	37.7	692	0.034	0.052	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
17	O35698	0.27	37.4	380	0.015	0.042	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
18	Q9LEB4	0.32	37.4	409	0.020	0.051	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
19	H0YAR2	0.40	37.0	599	0.036	0.063	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
20	P11940	0.42	37.0	636	0.036	0.060	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	8.8e-05	33.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240361	0.825	Inactive serine/threonine-protein kinase TEX14
2	9606.ENSP00000316674	0.825	Actin-like protein 9
3	9606.ENSP00000360540	0.781	Centrosomal protein of 55 kDa
4	9606.ENSP00000292779	0.755	Coiled-coil domain containing 116
5	9606.ENSP00000046087	0.741	Zona pellucida-binding protein 1
6	9606.ENSP00000374332	0.726	Translin
7	9606.ENSP00000362993	0.716	Protein bicaudal C homolog 1
8	9606.ENSP00000299213	0.703	La-related protein 6
9	9606.ENSP00000289805	0.702	Spermatogenesis-associated protein 2-like protein
10	9606.ENSP00000254661	0.695	Receptor activity-modifying protein 1
11	9606.ENSP00000007699	0.693	Y-box-binding protein 2
12	9606.ENSP00000341021	0.659	Nanos homolog 2
13	9606.ENSP00000384670	0.651	Acrosomal protein KIAA1210
14	9606.ENSP00000341992	0.650	Nanos homolog 3
15	9606.ENSP00000267594	0.631	Protein FAM181A
16	9606.ENSP00000341324	0.626	Serum response factor-binding protein 1
17	9606.ENSP00000380479	0.606	ELAV-like protein 2
18	9606.ENSP00000258111	0.591	Calcium-activated potassium channel subunit beta-4
19	9606.ENSP00000287748	0.552	Lysozyme-like protein 4
20	9606.ENSP00000360046	0.530	Uncharacterized protein C1orf141

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.965	heterocyclic compound binding
GO:0097159	0.965	organic cyclic compound binding
GO:0003676	0.955	nucleic acid binding
GO:0042802	0.910	identical protein binding
GO:0003723	0.889	RNA binding
GO:0042803	0.768	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.959	regulation of cellular process
GO:0071840	0.665	cellular component organization or biogenesis
GO:0016043	0.653	cellular component organization
GO:0019222	0.576	regulation of metabolic process
GO:0060255	0.507	regulation of macromolecule metabolic process
GO:0006996	0.501	organelle organization
GO:0048518	0.432	positive regulation of biological process
GO:0048522	0.392	positive regulation of cellular process
GO:0071704	0.378	organic substance metabolic process
GO:0010468	0.366	regulation of gene expression
GO:0080090	0.358	regulation of primary metabolic process
GO:0051171	0.351	regulation of nitrogen compound metabolic process
GO:0031323	0.348	regulation of cellular metabolic process
GO:0043170	0.315	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0045171	0.936	intercellular bridge
GO:0043226	0.845	organelle
GO:0016020	0.813	membrane
GO:0032991	0.756	protein-containing complex
GO:0043229	0.748	intracellular organelle
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0005829	0.591	cytosol
GO:0071944	0.389	cell periphery
GO:0005886	0.370	plasma membrane
GO:0043232	0.346	intracellular non-membrane-bounded organelle
GO:0005634	0.342	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]