StarFunc result for job id Q6ZP80

User Input

>input (229 residues)
MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCW
FNGIVEENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLM
LLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESY
RNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGWHIQIHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZP80	1.000	1.000	3.240E-39	229	1.000	1.000	Q6ZP80.pdb.gz	TM182_HUMAN Transmembrane protein 182 OS=Homo sapiens OX=9606 GN=TMEM182 PE=1 SV=2
2	AFDB:B2RVY9	0.996	0.996	1.360E-36	229	0.891	0.891	B2RVY9.pdb.gz	TM182_MOUSE Transmembrane protein 182 OS=Mus musculus OX=10090 GN=Tmem182 PE=1 SV=1
3	AFDB:A0A1D5NY17	0.967	0.950	7.466E-31	233	0.729	0.717	A0A1D5NY17.pdb.gz	TM182_CHICK Transmembrane protein 182 OS=Gallus gallus OX=9031 GN=TMEM182 PE=1 SV=2
4	AFDB:Q06432	0.696	0.716	9.825E-10	222	0.162	0.167	Q06432.pdb.gz	CCG1_HUMAN Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens OX=9606 GN=CACNG1 PE=1 SV=1
5	AFDB:B1AQL3	0.701	0.757	1.410E-9	211	0.205	0.223	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
6	AFDB:O70578	0.661	0.678	5.126E-9	223	0.175	0.179	O70578.pdb.gz	CCG1_MOUSE Voltage-dependent calcium channel gamma-1 subunit OS=Mus musculus OX=10090 GN=Cacng1 PE=1 SV=1
7	AFDB:Q9BXT2	0.691	0.615	7.357E-9	260	0.162	0.142	Q9BXT2.pdb.gz	CCG6_HUMAN Voltage-dependent calcium channel gamma-6 subunit OS=Homo sapiens OX=9606 GN=CACNG6 PE=1 SV=1
8	AFDB:P19518	0.653	0.670	8.589E-9	222	0.162	0.167	P19518.pdb.gz	CCG1_RABIT Voltage-dependent calcium channel gamma-1 subunit OS=Oryctolagus cuniculus OX=9986 GN=CACNG1 PE=1 SV=1
9	AFDB:Q8VHW8	0.681	0.577	9.523E-9	275	0.179	0.149	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
10	AFDB:Q9VRE6	0.685	0.373	1.233E-8	447	0.166	0.085	Q9VRE6.pdb.gz	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
11	PDB:7rz4A	0.645	0.165	1.195E-7	993	0.153	0.035	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:7ocaI	0.596	0.725	1.662E-6	185	0.127	0.157	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:6wxuB	0.494	0.430	7.053E-6	273	0.114	0.095	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
14	PDB:6ov2A	0.497	0.604	1.012E-5	182	0.153	0.192	6ov2A.pdb.gz
15	PDB:7rzaA	0.586	0.153	1.245E-5	981	0.183	0.043	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:5kbtA	0.535	0.147	1.380E-5	973	0.157	0.037	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
17	PDB:5weoA	0.595	0.158	2.196E-5	988	0.197	0.046	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
18	PDB:5b2gC	0.471	0.335	2.435E-5	350	0.122	0.080	5b2gC.pdb.gz
19	PDB:7d3eB	0.500	0.431	5.561E-5	272	0.118	0.099	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
20	PDB:6jp5E	0.457	0.591	2.241E-4	169	0.144	0.195	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZP80	7.51e-170	468	229	1.000	1.000	TM182_HUMAN Transmembrane protein 182 OS=Homo sapiens OX=9606 GN=TMEM182 PE=1 SV=2
2	B2RVY9	4.25e-149	416	229	0.891	0.891	TM182_MOUSE Transmembrane protein 182 OS=Mus musculus OX=10090 GN=Tmem182 PE=1 SV=1
3	A0A1D5NY17	3.16e-123	350	233	0.729	0.717	TM182_CHICK Transmembrane protein 182 OS=Gallus gallus OX=9031 GN=TMEM182 PE=1 SV=2
4	P62955	0.041	36.6	275	0.114	0.095	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
5	P62956	0.041	36.6	275	0.114	0.095	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
6	P62957	0.041	36.6	275	0.114	0.095	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
7	Q9VRM3	0.059	36.2	247	0.231	0.215	Q9VRM3_DROME Sinuous OS=Drosophila melanogaster OX=7227 GN=sinu PE=1 SV=3
8	Q8IVM8	0.13	35.4	553	0.148	0.061	S22A9_HUMAN Organic anion transporter 7 OS=Homo sapiens OX=9606 GN=SLC22A9 PE=1 SV=1
9	Q6PFS3	0.20	34.7	324	0.214	0.151	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
10	Q38AZ2	7.6	30.0	342	0.114	0.076	Q38AZ2_TRYB2 PhosphatidylinositolN-acetylglucosaminyltransferase subunit c, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0720 PE=3 SV=1
11	O88602	9.5	29.6	323	0.210	0.149	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
12	Q71RJ2	9.5	29.6	323	0.210	0.149	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
13	Q9Y698	9.8	29.6	323	0.210	0.149	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	6.2e-56	200.8	PMP-22/EMP/MP20/Claudin tight junction
2	PF00822 PMP22_Claudin	0.012	26.9	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317000	0.749	Transmembrane 6 superfamily member 1
2	9606.ENSP00000296862	0.702	Adhesion G-protein coupled receptor F2
3	9606.ENSP00000307280	0.642	Myosin light chain 1/3, skeletal muscle isoform
4	9606.ENSP00000307640	0.632	Tetratricopeptide repeat domain containing
5	9606.ENSP00000483872	0.618	Tetraspanin-33
6	9606.ENSP00000350377	0.584	Multiple C2 and transmembrane domain-containing protein 2
7	9606.ENSP00000289746	0.575	Cadherin-15
8	9606.ENSP00000262213	0.541	Translocating chain-associated membrane protein 1
9	9606.ENSP00000309402	0.537	Translocating chain-associated membrane protein 1-like 1
10	9606.ENSP00000347997	0.530	Ubiquilin-3
11	9606.ENSP00000384193	0.530	Cell adhesion molecule 2
12	9606.ENSP00000414670	0.530	Leiomodin-3
13	9606.ENSP00000301318	0.524	Zinc finger protein 28 homolog
14	9606.ENSP00000357425	0.512	Acid sphingomyelinase-like phosphodiesterase 3a
15	9606.ENSP00000337732	0.507	RUN domain containing 3B
16	9606.ENSP00000380671	0.503	Single-pass membrane protein with coiled-coil domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050793	0.989	regulation of developmental process
GO:0009987	0.988	cellular process
GO:0061061	0.982	muscle structure development
GO:0042692	0.972	muscle cell differentiation
GO:0050794	0.969	regulation of cellular process
GO:0051129	0.958	negative regulation of cellular component organization
GO:0051146	0.953	striated muscle cell differentiation
GO:0055001	0.953	muscle cell development
GO:0045661	0.943	regulation of myoblast differentiation
GO:0042246	0.937	tissue regeneration
GO:0060142	0.925	regulation of syncytium formation by plasma membrane fusion
GO:1901739	0.924	regulation of myoblast fusion
GO:0043403	0.924	skeletal muscle tissue regeneration
GO:0014904	0.920	myotube cell development
GO:0045596	0.862	negative regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0043226	0.923	organelle
GO:0005622	0.914	intracellular anatomical structure
GO:0043229	0.831	intracellular organelle
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0005737	0.748	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]