StarFunc result for job id Q6ZP82

User Input

>input (1450 residues)
MSSQGSPSVALSTTTVSSVAVQAGDSKIVIAVIKCGKWVQLQLAESQPNLLEIGSSQDET
KKLLHDHELLLAKLKALEDRVWELLQEADKTAEENKDQSQVYDAMAETLGEAWAALVSML
ERRTELLRLTSEFFENALEFAIKIDQAEDFLQNTHEFESAESLKSLLQLHEHHTKELLER
SLALLNKSQQLTDFIEKFKCEGPNVNPELTQGAHSSCLKVDRLLELLQDRRRQLDKYLKQ
QWQELSQVLQICQWDQQENQVTCWFQKTIRNLQEQSLGSSLSDNEDRIHKQEELIIKAKE
WNSAVEKLKSEALRILLSKDYVEKEHLQLSHQKLSQLQEEFGQLMVERNTWLKKANEFFN
SANKAFDVLGRVEAYLKLLKSEGLSLAVLAVRHEELHRKIKDCTTDALQKGQTLISQVDS
CSSQVSGIHEMMGCIKRRVDHLTEQCSAHKEYALKKQQLTASVEGYLRKVEMSIQKISPV
LSNAMDVGSTRSESEKILNKYLELDIQAKETSHELEAAAKTMMEKNEFVSDEMVSLSSKA
RWLAEELNLFGQSIDYRSQVLQTYVAFLKSSEEVEMQFQSLKEFYETEIPQKEQDDAKAK
HCSDSAEKQWQLFLKKSFITQDLGLEFLNLINMAKENEILDVKNEVYLMKNTMENQKAER
EELSLLRLAWQLKATESKPGKQQWAAFKEQLKKTSHNLKLLQEALMPVSALDLGGSLQFI
LDLRQKWNDMKPQFQQLNDEVQYIMKESEELTGRGAPVKEKSQQLKDLIHFHQKQKERIQ
DYEDILYKVVQFHQVKEELGRLIKSRELEFVEQPKELGDAHDVQIHLRCSQEKQARVDHL
HRLALSLGVDIISSVQRPHCSNVSAKNLQQQLELLEEDSMKWRAKAEEYGRTLSRSVEYC
AMRDEINELKDSFKDIKKKFNNLKFNYTKKNEKSRNLKALKYQIQQVDMYAEKMQALKRK
MEKVSNKTSDSFLNYPSDKVNVLLEVMKDLQKHVDDFDKVVTDYKKNLDLTEHFQEVIEE
CHFWYEDASATVVRVGKYSTECKTKEAVKILHQQFNKFIAPSVPQQEERIQEATDLAQHL
YGLEEGQKYIEKIVTKHKEVLESVTELCESLTELEEKLKQGDVLKMNPNLEDFHYDYIDL
LKEPAKNKQTIFNEERNKGQVQVADLLGINGTGEERLPQDLKVSTDKEGGVQDLLLPEDM
LSGEEYECVSPDDISLPPLPGSPESPLAPSDMEVEEPVSSSLSLHISSYGVQAGTSSPGD
AQESVLPPPVAFADACNDKRETFSSHFERPYLQFKAEPPLTSRGFVEKSTALHRISAEHP
ESMMSEVHERALQQHPQAQGGLLETREKMHADNNFTKTQDRLHASSDAFSGLRFQSGTSR
GYQRQMVPREEIKSTSAKSSVVSLADQAPNFSRLLSNVTVMEGSPVTLEVEVTGFPEPTL
TWWVAYNDKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZEY0	0.753	0.716	0.000	1530	0.712	0.675	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
2	AFDB:E9Q8Q6	0.713	0.677	0.000	1531	0.723	0.685	E9Q8Q6.pdb.gz	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
3	AFDB:Q6ZP82	1.000	1.000	0.000	1450	1.000	1.000	Q6ZP82.pdb.gz	CC141_HUMAN Coiled-coil domain-containing protein 141 OS=Homo sapiens OX=9606 GN=CCDC141 PE=1 SV=3
4	AFDB:Q8BLW1	0.234	0.446	4.984E-54	728	0.328	0.654	Q8BLW1.pdb.gz	Q8BLW1_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=2 SV=1
5	AFDB:Q498H0	0.064	0.064	6.166E-6	1448	0.121	0.122	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
6	AFDB:A0A166B1A6	0.050	0.061	1.062E-5	1119	0.126	0.163	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
7	AFDB:Q6TRW4	0.061	0.061	9.348E-5	1447	0.124	0.124	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
8	AFDB:Q8N9W4	0.046	0.070	4.169E-4	909	0.094	0.150	Q8N9W4.pdb.gz	GG6L2_HUMAN Golgin subfamily A member 6-like protein 2 OS=Homo sapiens OX=9606 GN=GOLGA6L2 PE=1 SV=3
9	PDB:4d1eA	0.113	0.171	7.529E-4	859	0.050	0.084	4d1eA.pdb.gz
10	AFDB:X1WD79	0.053	0.066	9.007E-4	1138	0.086	0.110	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
11	AFDB:A0A0B4K7Q6	0.067	0.053	2.672E-3	2008	0.108	0.078	A0A0B4K7Q6.pdb.gz	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
12	PDB:1sjjA	0.133	0.200	2.678E-3	863	0.039	0.065	1sjjA.pdb.gz
13	PDB:7ktuA	0.079	0.107	1.716E-2	995	0.074	0.108	7ktuA.pdb.gz
14	PDB:6vaeA	0.053	0.061	4.059E-2	1198	0.100	0.121	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
15	PDB:3icqT	0.054	0.075	4.444E-2	949	0.060	0.092	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
16	PDB:6nr7A	0.060	0.076	6.102E-2	1086	0.082	0.110	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
17	PDB:7peqAD	0.055	0.098	6.991E-2	678	0.058	0.124	7peqAD.pdb.gz
18	PDB:6fuyA	0.054	0.075	1.051E-1	961	0.083	0.125	6fuyA.pdb.gz
19	PDB:7fikI	0.068	0.120	1.100E-1	729	0.060	0.119	7fikI.pdb.gz
20	PDB:1tr2B	0.065	0.083	1.151E-1	1029	0.076	0.107	1tr2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZEY0	0.0	2049	1530	0.712	0.675	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
2	E9Q8Q6	0.0	2071	1531	0.723	0.685	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
3	Q6ZP82	0.0	2979	1450	1.000	1.000	CC141_HUMAN Coiled-coil domain-containing protein 141 OS=Homo sapiens OX=9606 GN=CCDC141 PE=1 SV=3
4	Q8BLD3	0.0	971	655	0.345	0.763	Q8BLD3_MOUSE Coiled-coil domain-containing 141 (Fragment) OS=Mus musculus OX=10090 GN=Ccdc141 PE=2 SV=1
5	Q8BLW1	0.0	633	728	0.264	0.526	Q8BLW1_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=2 SV=1
6	Q9D003	0.0	655	422	0.235	0.808	Q9D003_MOUSE Coiled-coil domain-containing 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=2 SV=1
7	J3QNK9	6.08e-51	179	154	0.061	0.571	J3QNK9_MOUSE Coiled-coil domain containing 141 (Fragment) OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=1
8	Q8BUK9	1.63e-45	161	114	0.054	0.684	Q8BUK9_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Ccdc141 PE=2 SV=1
9	D6RJ38	1.02e-35	132	78	0.046	0.846	D6RJ38_MOUSE Coiled-coil domain containing 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=1
10	A2AK24	2.00e-35	133	117	0.047	0.581	A2AK24_MOUSE Coiled-coil domain containing 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=1
11	J3QN68	1.54e-33	129	157	0.048	0.439	J3QN68_MOUSE Coiled-coil domain containing 141 (Fragment) OS=Mus musculus OX=10090 GN=Ccdc141 PE=4 SV=1
12	Q0E8J4	9.12e-26	119	3079	0.150	0.071	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	Q0E8J3	1.41e-25	118	3640	0.150	0.060	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
14	Q9W053	1.94e-25	117	2935	0.150	0.074	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
15	Q7Z1Y4	3.36e-25	117	2935	0.150	0.074	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
16	M9PBJ1	4.26e-25	116	3664	0.154	0.061	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
17	Q0E8J5	8.74e-25	115	2960	0.154	0.075	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
18	M9PE03	1.81e-22	108	3536	0.073	0.030	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
19	Q2YDR5	1.91e-05	52.0	895	0.043	0.069	Q2YDR5_DANRE Actinin, alpha 2 OS=Danio rerio OX=7955 GN=actn2 PE=1 SV=1
20	Q7KVD1	4.19e-05	50.8	2263	0.062	0.040	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06103 DUF948	32	16.2	Bacterial protein of unknown function (DUF948)
2	PF00700 Flagellin_C	6.7e+02	12.0	Bacterial flagellin C-terminal helical region
3	PF07679 I-set	0.14	23.6	Immunoglobulin I-set domain
4	PF13927 Ig_3	10	18.1	Immunoglobulin domain
5	PF15796 KELK	23	16.7	KELK-motif containing domain of MRCK Ser/Thr protein kinase
6	PF00435 Spectrin	0.009	27.8	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355593	0.941	Disrupted in schizophrenia 1 protein
2	9606.ENSP00000295131	0.626	E3 ubiquitin-protein ligase ZSWIM2
3	9606.ENSP00000321475	0.624	Kelch-like protein 38
4	9606.ENSP00000415332	0.596	SEC14 domain and spectrin repeat-containing protein 1
5	9606.ENSP00000353557	0.525	Solute carrier family 35 member F1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0032501	0.963	multicellular organismal process
GO:0016477	0.948	cell migration
GO:0007399	0.939	nervous system development
GO:0021987	0.929	cerebral cortex development
GO:0021885	0.925	forebrain cell migration
GO:0021795	0.922	cerebral cortex cell migration
GO:0051642	0.921	centrosome localization
GO:0021799	0.905	cerebral cortex radially oriented cell migration
GO:0050789	0.387	regulation of biological process
GO:0050794	0.345	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005813	0.999	centrosome
GO:0043227	0.696	membrane-bounded organelle
GO:0043231	0.450	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]