StarFunc result for job id Q6ZQN5

User Input

>input (318 residues)
MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPA
PPYAAPSYGAPGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPL
RKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDP
NCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPE
AATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTA
AAGFRLSHLLYSREGTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7T2N8	0.360	0.275	9.552E-27	419	0.494	0.375	Q7T2N8.pdb.gz
2	AFDB:A0A2R8QK25	0.386	0.325	5.656E-26	383	0.478	0.397	A0A2R8QK25.pdb.gz
3	AFDB:B3DGC2	0.416	0.354	1.111E-25	383	0.513	0.426	B3DGC2.pdb.gz
4	AFDB:Q7ZYQ0	0.387	0.334	2.787E-25	373	0.472	0.402	Q7ZYQ0.pdb.gz	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
5	AFDB:E0XEN6	0.367	0.311	8.405E-25	378	0.509	0.429	E0XEN6.pdb.gz	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
6	AFDB:Q922I5	0.364	0.313	7.646E-24	372	0.484	0.414	Q922I5.pdb.gz	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
7	AFDB:Q91904	0.370	0.319	1.249E-23	370	0.440	0.378	Q91904.pdb.gz	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
8	AFDB:Q91905	0.382	0.333	1.804E-23	367	0.443	0.384	Q91905.pdb.gz	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
9	AFDB:Q63248	0.308	0.950	2.728E-17	101	0.292	0.921	Q63248.pdb.gz	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
10	AFDB:Q9DE25	0.311	0.211	3.813E-16	476	0.305	0.204	Q9DE25.pdb.gz	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
11	PDB:2hdcA	0.252	0.684	1.602E-8	97	0.195	0.639	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:2fe3B	0.174	0.346	4.757E-2	143	0.038	0.084	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
13	PDB:2nyxB	0.200	0.379	9.930E-2	147	0.035	0.075	2nyxB.pdb.gz
14	PDB:4etsB	0.184	0.356	1.056E-1	149	0.035	0.074	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
15	PDB:5hs7A	0.178	0.461	1.269E-1	102	0.028	0.088	5hs7A.pdb.gz
16	PDB:2qbyB	0.183	0.162	1.435E-1	368	0.044	0.038	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
17	PDB:6iwtA	0.169	0.157	1.435E-1	346	0.050	0.046	6iwtA.pdb.gz
18	PDB:6zmiCE	0.181	0.691	1.435E-1	72	0.041	0.181	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
19	PDB:5k1yD	0.165	0.494	1.622E-1	92	0.038	0.130	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
20	PDB:1kywC	0.186	0.167	1.834E-1	361	0.063	0.055	1kywC.pdb.gz	Structural basis for the modulation of lignin monomer methylation by caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q804B2	8.98e-88	269	377	0.487	0.411	Q804B2_DANRE Forkhead box protein I2 OS=Danio rerio OX=7955 GN=cb724 PE=2 SV=1
2	E0XEN6	1.97e-86	266	378	0.428	0.360	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
3	Q12951	1.97e-86	266	378	0.428	0.360	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3
4	Q6NY62	6.14e-85	262	383	0.478	0.397	Q6NY62_DANRE Forkhead box I2 OS=Danio rerio OX=7955 GN=foxi2 PE=2 SV=2
5	Q7T1C0	9.62e-83	256	383	0.425	0.352	FXI3B_DANRE Forkhead box protein I3-B OS=Danio rerio OX=7955 GN=foxi3b PE=2 SV=1
6	Q7ZYQ0	3.44e-82	255	373	0.484	0.413	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
7	A3KNJ3	1.05e-77	243	353	0.447	0.402	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
8	Q91905	1.45e-76	240	367	0.421	0.365	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
9	Q91904	4.31e-76	239	370	0.431	0.370	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
10	Q922I5	6.05e-70	223	372	0.415	0.355	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
11	Q63248	2.53e-61	192	101	0.274	0.861	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
12	Q7SY22	4.63e-42	150	363	0.255	0.223	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
13	Q64731	9.67e-42	149	336	0.192	0.182	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
14	Q12952	1.17e-41	149	345	0.195	0.180	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
15	Q61850	2.22e-40	149	494	0.195	0.126	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
16	Q63246	2.67e-40	149	494	0.195	0.126	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
17	Q99958	2.95e-40	149	501	0.195	0.124	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
18	Q12948	4.84e-40	149	553	0.252	0.145	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3
19	W6CJ52	4.84e-40	149	553	0.252	0.145	W6CJ52_HUMAN Forkhead box C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=4 SV=1
20	Q9PVY9	1.13e-39	147	465	0.192	0.131	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	6.8e-35	130.4	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352821	0.738	Probable palmitoyltransferase ZDHHC14
2	9606.ENSP00000263334	0.716	Paired box protein Pax-8
3	9606.ENSP00000398273	0.672	Transcription factor SOX-5
4	9606.ENSP00000389870	0.666	Homeobox protein DLX-3
5	9606.ENSP00000322568	0.625	Transcription factor SOX-11
6	9606.ENSP00000334122	0.603	Fibroblast growth factor 3
7	9606.ENSP00000318085	0.555	Histone H4 transcription factor
8	9606.ENSP00000359567	0.555	Transcription factor SOX-3
9	9606.ENSP00000368632	0.552	Trans-acting T-cell-specific transcription factor GATA-3
10	9606.ENSP00000331698	0.543	ATP-sensitive inward rectifier potassium channel 15
11	9606.ENSP00000357660	0.541	Clarin-3
12	9606.ENSP00000449960	0.522	Calcium-binding and coiled-coil domain-containing protein 1
13	9606.ENSP00000357633	0.517	Glutaredoxin-3
14	9606.ENSP00000429763	0.517	Protein FAM196A
15	9606.ENSP00000342626	0.516	Eyes absent homolog 1
16	9606.ENSP00000428402	0.514	Clavesin-1
17	9606.ENSP00000321797	0.510	Fibroblast growth factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	0.995	double-stranded DNA binding
GO:1990837	0.986	sequence-specific double-stranded DNA binding
GO:0005515	0.973	protein binding
GO:0000976	0.962	transcription cis-regulatory region binding
GO:0000981	0.782	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.623	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.492	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.990	anatomical structure development
GO:0007275	0.980	multicellular organism development
GO:0065007	0.959	biological regulation
GO:0009987	0.865	cellular process
GO:0050789	0.815	regulation of biological process
GO:0048731	0.800	system development
GO:0050794	0.746	regulation of cellular process
GO:0019222	0.698	regulation of metabolic process
GO:0060255	0.686	regulation of macromolecule metabolic process
GO:0010468	0.660	regulation of gene expression
GO:0019219	0.586	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.457	regulation of biosynthetic process
GO:0031326	0.393	regulation of cellular biosynthetic process
GO:0048513	0.388	animal organ development
GO:0048518	0.383	positive regulation of biological process
GO:1903506	0.375	regulation of nucleic acid-templated transcription
GO:0006355	0.374	regulation of DNA-templated transcription
GO:0048522	0.356	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.740	intracellular organelle lumen
GO:0031981	0.545	nuclear lumen
GO:0005654	0.465	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]