StarFunc result for job id Q6ZQQ2

User Input

>input (1576 residues)
MENILCFLNSYTETGLSPDSHWLDIDPNFICLSGLGLFILYLFYVVLTLYSSPTEKNNDI
QKHQGRAKRRRKGGTFKGFPDWKSFQREEEEERKLLSLLKSFGPPVSCSPRGQHHDTNHF
RRLLCPDPVCRVCKRATADIQQLLSWESLKDAAPSVSPLASSASATESSFTLASTPSATP
PEDLILSPRPKASPPPPLILSPDLITTLADLFSPSPLRDPLPPQPVSPLDSKFPIDHSPP
QQLPFPLLPPHHIERVESSLQPEASLSLNTIFSFGSTLCQDISQAMNPIDSCARHHGPPI
PSALPPEDCTVTQSKSSLTILKTFPEMLSLGGSGGSSTSAPTIKGIDHSHLASSEFTWWQ
PHAKDSFSSNFVPSDFMEELLTLHSSEAFLGGHSVANLIEPVNISFLSHDILALLERQVK
KRGDFLMWKENGKKPGSFPKQLRPNYQLNSSRNMLTSIAVKHDLAESFPFWASKGKLEWQ
HIHQQPPHSKCFEDHLEQKYVQLFWGLPSLHSESLHPTVLVQRGHSSMFVFFNGITNTSI
SHESPVLPPPQPLSLPSTQPLPLPQTLPQGQSPHLTQVKSLAQPQSPFRALLPSPLFLIR
ICGVCFHRPQNEARSLLPSEINHLEWNVLQKVQESLWGLPSVVQKSQEDFCPPAPNPELV
RKSFKVHVPISIIPGDFPLSSEVRKKLEQHIRRRLIQRRWGLPRRIHESLSLLRPQSKIS
ELSVSERIHGPLNISLVEGQRCNVLKKSASSFPRSFHERSSNMLSMENVGNYQGYSQETV
PKDHLLHGPETSSDKDLRSNSERDLETHMMHLSGNDSGVRLGQKQLENALTVRLSKKFEE
INEGRMPGTVHSSWHSVKQTMSLPEKSHSQIKHRNLVTLVSEDHCVDTSQEISFLSSNKQ
KMLEAHIKTFRMRMLWGLPLKVLESIEIFKSKADLSTSFSHFDLPSSATFISQGDSKDGV
SKSRSRSTFQGEKLGTTSSVPILDRPHPVSSPVVQEGQGTLRRQFSDTDHDLIETDSKDG
ASTSLRRGTTDFQSEKLDSTSSFPILGHSYLVTSPVNQEKQGTLRREFSDTDNDLTESVR
TTEDGRQTFLPPPHSIVDEVSQKQTVLASRCSAELPIMQAGAGCESWDKRKSSFHNVDRL
QGSRKTFPVTNALQSQTRNNLTTSKSGSCSLTNVKASTSNETEIFPPRISVPQDPKSSYL
KNQMLSQLKLVQRKHSQPQSHFTDMSFALDNLSSKDLLTNSQGISSGDMGTSQVVHVHLE
DSGIRVAQKQEPRVPTCVLQKCQVTNFPPAVNRVSPVRPKGGELDGGDAGLGTSQRRRKS
LPVHNKTSGEVLGSKSSPTLKTQPPPENLFRKWMKTSLQWFNKPSISYEEQESSWEKGSS
LSSCVQNIGRVIRAAFTGTTEAQKIRKDTREFLEEKLGHRHGIDITCPQEPLSFPVGLGK
AQHNPEVHVRAEPVQGCPCNYRAPSCKVTRTKSCSQQAIFVGQNYPTRIRQIIDKDRQPQ
KVEAFKGKILCQSHPQSMPHRKPVPHPNPTCRRQVSLVCPAVPTSAKSPVFSDVPFLTGQ
KMLPKHLQGGKFPPTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZU69	0.046	0.052	3.230E-14	1335	0.182	0.215	Q6ZU69.pdb.gz	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
2	AFDB:P21263	0.030	0.026	1.787E-8	1893	0.147	0.123	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
3	AFDB:Q6P5H2	0.035	0.031	1.286E-7	1864	0.148	0.126	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	AFDB:Q4AB30	0.028	0.037	1.567E-6	1044	0.092	0.139	Q4AB30.pdb.gz	Q4AB30_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=1
5	AFDB:Q9V9S7	0.033	0.029	1.374E-5	1866	0.155	0.131	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
6	AFDB:P23226	0.038	0.044	1.909E-5	1185	0.097	0.129	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
7	AFDB:F1R405	0.037	0.037	2.326E-5	1573	0.141	0.142	F1R405.pdb.gz	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
8	AFDB:Q7TPM1	0.041	0.043	3.451E-5	1486	0.139	0.147	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
9	AFDB:O00512	0.033	0.036	4.796E-5	1426	0.138	0.153	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
10	AFDB:P21519	0.039	0.039	9.259E-5	1594	0.121	0.119	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
11	PDB:7t3aM	0.026	0.210	1.911	115	0.010	0.139	7t3aM.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
12	PDB:7r5jA0	0.022	0.034	5.128	818	0.011	0.022	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:5iy7M	0.023	0.092	8.679	310	0.011	0.058	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
14	PDB:5ganG	0.029	0.109	9.269	318	0.007	0.035	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
15	PDB:5nrlG	0.029	0.095	9.269	372	0.005	0.022	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	1.63e-59	228	1347	0.162	0.190	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	1.30e-48	192	1048	0.117	0.176	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	Q6ZU69	1.15e-11	72.4	1335	0.074	0.088	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
4	Q6GQS8	1.88e-06	55.1	569	0.043	0.120	Q6GQS8_MOUSE SPATA31 domain-containing protein OS=Mus musculus OX=10090 GN=Gm21093 PE=2 SV=1
5	Q9H5C5	0.16	38.1	234	0.014	0.094	Q9H5C5_HUMAN HCG1643967 OS=Homo sapiens OX=9606 GN=FLJ23584 PE=1 SV=1
6	Q3V2G4	1.7	32.3	71	0.011	0.254	SIM31_MOUSE Small integral membrane protein 31 OS=Mus musculus OX=10090 GN=Smim31 PE=3 SV=1
7	Q8IPM1	3.2	35.0	1067	0.018	0.026	Q8IPM1_DROME FI18188p1 OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=2
8	Q8IPM0	3.3	34.7	1058	0.018	0.026	Q8IPM0_DROME Spargel, isoform D OS=Drosophila melanogaster OX=7227 GN=srl PE=4 SV=3
9	Q5SQP1	4.7	33.9	306	0.015	0.075	HORM2_MOUSE HORMA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Hormad2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	7.6e-33	124.0	Domain of unknown function (DUF4599)
2	PF14650 FAM75	7.5e-150	511.3	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341988

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262487	0.762	Isthmin-1
2	9606.ENSP00000429073	0.753	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
3	9606.ENSP00000366645	0.674	SCP2 sterol-binding domain-containing protein 1
4	9606.ENSP00000377369	0.653	Leucine-rich repeat-containing protein 74A
5	9606.ENSP00000355923	0.637	Tyrosine-protein phosphatase non-receptor type 14
6	9606.ENSP00000393198	0.606	Hes family bHLH transcription factor 4
7	9606.ENSP00000367130	0.586	Transcription factor HES-3
8	9606.ENSP00000311957	0.556	Protein ZNF738
9	9606.ENSP00000478962	0.551	Protein chibby homolog 1
10	9606.ENSP00000346088	0.512	Ribosomal protein L22
11	9606.ENSP00000310226	0.504	Ras-related protein Rab-1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.959	biological regulation
GO:0050789	0.909	regulation of biological process
GO:0050794	0.888	regulation of cellular process
GO:0009987	0.874	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.987	endomembrane system
GO:0005634	0.976	nucleus
GO:0031982	0.753	vesicle
GO:0031410	0.531	cytoplasmic vesicle
GO:0070013	0.350	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]